PRGDB00064580 (Zm.139025)

From PRG Wiki
Jump to: navigation, search
Zm.139025
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 195625091 (EU962258)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays clone 241338 mRNA sequence

DNA Sequence

GGAGGTCACCACCACTCTTGGCGAAGCGAAATCCACCGTACACCGCTGCCTCCCTCTCCCTGTCTCGTCTCGTCGAACCAGCCGAGGAAGCCAACGCAGACCCAGCGATCCTCGTCGCGCGTCCTCCTCCCCCACGGAGGGAAGGATGGCGGAGCCCAAAGCGGCGGCGGCGGCGAGGAAGACGCGGGTGGGCCCGTACGAGGTCGGCAAGACCATCGGCGAGGGCAGCTTCGCCAAGGTCAAGCACGCGCGCGACTCCCGCACCGGCGCCGTCCGCGCCATCAAGGTGCTCGACCGCAACCACGTCCTCCGCCACAGGATGGTCGAGCAGATCAAGCGGGAGATTTCGACTATGAAGCTGATCAAACATCCCAATGTGGTACAGCTGCATGAGGTTATGGCGAGCAAAACGAAGATATACATGGTTCTTGAATTTGTTGATGGAGGCGAGCTATTCGATAAGATCGTCAATTCTGGAAGGCTAGGAGAGGATGAAGCTAGGATATACTTTCATCAACTTATAAATGCAGTTGATTATTGCCATAGCCGAGGAGTGTACCATAGAGACCTGAAGCCAGAGAATTTGCTTCTGGATTCAAATGGAGCTCTTAAAGTTTCAGACTTCGGCCTAAGTGCATTTGCACCACAAACAAATGAGGATGGGCTTCTGCATACTACCTGTGGAACTCCAAACTATGTAGCACCTGAGGTGCTTGCTGATAAAGGCTATGATGGTATGGCTGCAGATGTATGGTCCTGTGGCATAATCTTATTTGTTCTTATGGCTGGATACTTACCCTTTGATGATGCCAATCTGATGAGACTGTACAAACTGATCTGCCAAGCATATTTTTCTTGCCCACCATGGTTTTCTTCTGGAGCGAAGAAGTTTATTAAGCGCATTCTCGATCCTAATCCTGATACGAGGATAACAATTGCAGAAATTTTGGAAGATGAATGGTTCAAAAAAGACTATAAACCACCACGTTTTGAACAAGGTGAAGGTGTTAGCCTTGACGACATTGATGCTGCATTCAATGATTCAGAGGACCGTCTTGTGGCAGAGAAAAGAGAGAAACCAGAATCCATGAACGCATTTGCTCTTATTTCGAGGTCGCAGGGTTTCAACCTTGGAAATTTGTTTGAGAAGGAGATGATGATGAAATTGAAAGGTGACAAATCTGGAAGAAAAGGTCACTTATCTGTTGCAACTGAGGTTTTTGAGGTTGCCCCATCACTTCACATGGTTGAGCTTCGTAAAACCGGAGGAGACACATTGGAGTTCCACAGCTTCTACAAGAACTTCTCATCGGAGCTGAAAGATATCGTGTGGAAAGCTGAATCTGACGCAAATAATAAACAGACGAATAAGTGATACCCAGAGAATCTGTGTAGCCCTCATGAGGCCACATTCAGATAGACCACCTCTTCGGGTGATACCACCTGCTTGGTACTGTATGCttttttttttACTGGTACCACATTAGCAGCCAAAATCTCTTGTAAACGGGAGCTCCTTCTGAATGAGCGCAATTGTACAAAACACATATGAAGAGGCGAGGCCCTCCGTGAGATGCTCCGAACACTGCAATGGGATGTCAAATAGTTCTGAATGGTGAGTGCTGTTTTTGCACaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.139025 translated coding region predicted by ESTScan from UniGene Zm.139025

XEVTTTLGEAKSTVHRCLPLPVSSRRTSRGSQRRPSDPRRASSSPTEGRMAEPKAAAAARKTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPPRFEQGEGVSLDDIDAAFNDSEDRLVAEKREKPESMNAFALISRSQGFNLGNLFEKEMMMKLKGDKSGRKGHLSVATEVFEVAPSLHMVELRKTGGDTLEFHSFYKNFSSELKDIVWKAESDANNKQTNK

Domains

Domain Start-End Description Sequence

Seg: seg
23-45 seg

SSRRTSRGSQRRPSDPRRASSSP

superfamily: SSF56112
IPR011009
53-350 Protein kinase-like (PK-like)
Protein kinase-like domain

PKAAAAARKTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPPRFEQGEGVSLDDIDAAFNDSE

Seg: seg
55-59 seg

AAAAA

Gene3D: G3DSA:3.30.200.20
59-174 no description

ARKTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQL

HMMPanther: PTHR24345:SF45
61-454 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK1

KTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPPRFEQGEGVSLDDIDAAFNDSEDRLVAEKREKPESMNAFALISRSQGFNLGNLFEKEMMMKLKGDKSGRKGHLSVATEVFEVAPSLHMVELRKTGGDTLEFHSFYKNFSSELKDIVWKAESDANNK

HMMPanther: PTHR24345
61-454 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK

KTRVGPYEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPPRFEQGEGVSLDDIDAAFNDSEDRLVAEKREKPESMNAFALISRSQGFNLGNLFEKEMMMKLKGDKSGRKGHLSVATEVFEVAPSLHMVELRKTGGDTLEFHSFYKNFSSELKDIVWKAESDANNK

HMMPfam: PF00069
IPR017442
67-322 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWF

ProfileScan: PS50011
IPR000719
67-322 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWF

HMMSmart: SM00219
IPR020635
67-321 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEW

HMMSmart: SM00220
IPR002290
67-322 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEVGKTIGEGSFAKVKHARDSRTGAVRAIKVLDRNHVLRHRMVEQIKREISTMKLIKHPNVVQLHEVMASKTKIYMVLEFVDGGELFDKIVNSGRLGEDEARIYFHQLINAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWF

PatternScan: PS00107
IPR017441
73-96 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSFAKVKHARDSRTGAVRAIK

Gene3D: G3DSA:1.10.510.10
175-329 no description

INAVDYCHSRGVYHRDLKPENLLLDSNGALKVSDFGLSAFAPQTNEDGLLHTTCGTPNYVAPEVLADKGYDGMAADVWSCGIILFVLMAGYLPFDDANLMRLYKLICQAYFSCPPWFSSGAKKFIKRILDPNPDTRITIAEILEDEWFKKDYKPP

PatternScan: PS00108
IPR008271
186-198 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

ProfileScan: PS50816
IPR018451
359-383 NAF
NAF/FISL domain

EKPESMNAFALISRSQGFNLGNLFE

HMMPfam: PF03822
IPR004041
360-387 NAF
NAF domain

KPESMNAFALISRSQGFNLGNLFEKEMM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox