PRGDB00064586 (Zm.139444)

From PRG Wiki
Jump to: navigation, search
Zm.139444
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238006277 (BT083821)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0043C09 mRNA, complete cds

DNA Sequence

CGTTCCTGGCGTGGGAGCGGCGGTACCGGATCGCGCTGGAGGCGGCGCGCGGGCTGTGCTACCTCCACCACGACTGCACGCCCATGATCGTGCACCGGGACGTCAAGTCCAACAACATCCTCCTCGGCGACAACCTGGAGGCCCGCGTCGCGGACTTCGGCCTCGCCAAGTTCCTCCGGTGCGGCGCCACCTCCGAGTCCATGTCCGCCGTCGCTGGATCCTACGGCTACATCGCCCCTGAGTACGCGTACACGCTGCGGGTGGACGAGAAGAGCGACGTGTACAGCTACGGCGTGGTCCTGCTGGAGCTCATCACGGGCCGCCGCCCCGTGGGGGACTTCGGGGAAGGTGTGGACATCGTGCAGTGGGCGAAGCGGGCCACGGccggccgccgggaggccgtgccggggatcgtggaccgccggctcgtcggcggcgcgccggccgACGAGGTGGCGCACCTATTCTTCGTCTCCATGCTCTGCGTGCAGGACAATAGCGTGGAGCGCCCCACCATGCGCGAGGTGGTGCAGATGCTCGCCGAGCTCCCGCGCCACgagtcgtcgccgtccacctcctcctcctcctcgtcgtcgtcgGCGGTGGAACCGCCACCACCGCAGGCCGGCGAGGAGAGCAGCCCCGACGACGGGAAGGAGCCGCCGGCCAACTGCTACAAGCTGTTCCCGGACCTGCTGGCCTGATAAACTGAAGCGCAGACGACGGAACCTATTTTGCTGCCATTGTTACAAGACACAAGGCTACTACTCAATCGTCGTGCAGGGCTAAAGTTACAGCATGTAGTGCAGAATGGAGCTAGACGTTCAACAGGTTGGTCGGCCGACATTGGAAATGGTGACAAGATAGAGCTGGGAATCAATAACATGTAacttttttttgtctttcttcttcttcttctatctcctctccgaattattttctttttgttcATCTATCAATTCAAAGCTGTATAGGGTCTGATCATATGCTACCGCCTATCTAGGGGATTATGCTGTCCGAGATGCAGTAGCATCCCTTCCATCATCATAGCTTTCGCACTTTTGTAATCTCCTGGTAATCTTTAGCC


Protein sequences

Name Description Sequence
Zm.139444 translated coding region predicted by ESTScan from UniGene Zm.139444

XFLAWERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQMLAELPRHESSPSTSSSSSSSSAVEPPPPQAGEESSPDDGKEPPANCYKLFPDLLAXXTEAQTTEPILLPLLQDTRLLLNRRAGLKLQHVVQNGARRSTGWSADIGNGDKIELGINNM

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-189 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XFLAWERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQMLAELPRHESS

HMMSmart: SM00219
IPR020635
1-180 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XFLAWERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQML

HMMPanther: PTHR24420
2-260 FAMILY NOT NAMED,FAMILY NOT NAMED

FLAWERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQMLAELPRHESSPSTSSSSSSSSAVEPPPPQAGEESSPDDGKEPPANCYKLFPDLLAXXTEAQTTEPILLPLLQDTRLLLNRR

HMMPanther: PTHR24420:SF462
2-260 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FLAWERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQMLAELPRHESSPSTSSSSSSSSAVEPPPPQAGEESSPDDGKEPPANCYKLFPDLLAXXTEAQTTEPILLPLLQDTRLLLNRR

HMMSmart: SM00220
IPR002290
2-180 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FLAWERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQML

superfamily: SSF56112
IPR011009
3-188 Protein kinase-like (PK-like)
Protein kinase-like domain

LAWERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQMLAELPRHES

Gene3D: G3DSA:1.10.510.10
3-214 no description

LAWERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQMLAELPRHESSPSTSSSSSSSSAVEPPPPQAGEESS

HMMPfam: PF00069
IPR017442
5-177 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

WERRYRIALEAARGLCYLHHDCTPMIVHRDVKSNNILLGDNLEARVADFGLAKFLRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVV

PatternScan: PS00108
IPR008271
30-42 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKSNNILL

Seg: seg
188-207 seg

SSPSTSSSSSSSSAVEPPPP

Seg: seg
246-260 seg

LLPLLQDTRLLLNRR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox