PRGDB00064598 (Zm.140133)

From PRG Wiki
Jump to: navigation, search
Zm.140133
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 78087223 (DV515616)
Gene Class Mlo-like
Domain Type MLO
Gene Species Zea mays

Comment?

ZM_BFb0198E12.f ZM_BFb Zea mays cDNA 3', mRNA sequence

DNA Sequence

GGAGAAAATAGTGCAATTCGGATTCATAAAGCAATAGAAACCACTCTAGATGAGACAGAACGCAGCCGCCAATCAAATCCCAGCCAGGGACCCTGCTGCAGCAGACCAACTGTGGATAATAATATCGAACAAGGATTCGCCGAATTAGTACAAAGCCCAGAACCAAAGGACAATCTGGGAGCACAGGGATACAGAGGCACGCTATAGCACTGCCCAAACACACTAAAACTAGCAGGAATTAAAATGAGAAACAAGGATGGGGTGGACCCGGAACCGCGCCAAAAGCGCCTATCCATCTGAGGAACCATTGATCAGCAAAAGAACCACCAACAAACCCAGACGCAGCAGCTCAGAACCCCTTAGCCTTCCCGGCTTCGGCGGTTGGCATCACCTTTCGACCCTTCTTTTTAGTCTTCCCTGCCTTCACGTTGTCTTGATTTATCAGCTCCATGATTGCCTCCATTTGGCACTTGGTAAGAGGCCTTGTGAATAGACTTGCGATCATTGACATTGAGGAATAGGAAGATGAGAGCAGAAGCCCACAAAGGAGGGCTGATCCCCACGATCACCTTGAAGTCGTCCTCCAGAGACCGCTTGATGTACTTTTGGAAATCAAACTTGGTGCCAGGGGCCAGATGGACGTTGACAAAGCTGTGGCGCAGCGCGCAGTAGTCTGCCCGCCTGACGGACCTGAAGAACTGCCGGAAGAAGTTGCTGATGTAGAAGGATGCTGGGAACTTGTTGAGCACATTCATATGCTGCC


Protein sequences

Name Description Sequence
Zm.140133 translated coding region predicted by ESTScan from UniGene Zm.140133

XQHMNVLNKFPASFYISNFFRQFFRSVRRADYCALRHSFVNVHLAPGTKFDFQKYIKRSLEDDFKVIVGISPPLWASALIFLFLNVNDRKSIHKASYQVPNGGNHGADKSRQVKAGKTKKKGRKVMPTAEAGKAKGFXAAASGFVGGSFADQWFLRWIGAFGAVPGPPHPCFSF

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
2-91 Mlo
Mlo-related protein

QHMNVLNKFPASFYISNFFRQFFRSVRRADYCALRHSFVNVHLAPGTKFDFQKYIKRSLEDDFKVIVGISPPLWASALIFLFLNVNDRKS

Seg: seg
114-124 seg

KAGKTKKKGRK

Seg: seg
131-150 seg

AGKAKGFXAAASGFVGGSFA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox