PRGDB00064609 (Zm.140543)

From PRG Wiki
Jump to: navigation, search
Zm.140543
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 148984035 (EE029537)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Zea mays

Comment?

ZM_BFc0088I03.f ZM_BFc Zea mays cDNA clone ZM_BFc0088I03 5', mRNA sequence

DNA Sequence

GGCTGGCTCGGATGCGGACGCGCTGCTGGCGGCGAAGGCGGTGCTGTCGGACCCGGCCGGCGCGCTCGCGTCCTGGACGAACGCCACCAGCACCGGCGCCTGCGCGTGGTCCGGCGTGACGTGCAACGCGCGCGCCGCGGTCATCGGCCTCGACCTCTCCGGCCGCAACCTCTCGGGCCCGGTGCCCACGGCGCTGTcccgcctcgcgcacctcgcgcgcctcgacctcgccgcgaacgcgctcTGCGGCCCCATCCCGGCGCCGCTGTCCCGGCTCCAGTCCCTCACCCACCTCAACCTCTCCAACAACGTGCTCAACGGCACCTTCCCGCCGCCGCTCGCGCGCCTGCGGGCGCTCCGCGTGCTCGACCTCTACAACAACAACCTCACCGGCCCGCTCCCGCTCGCGGTCGTGGGCCTGCCGGTGCTCCGCCACCTCCACCTCGGCGGCAACTTCTTCTCCGGCGAGATCCCGCCCGAGTACGGCCGCTGGCGGAGGCTGCAGTACCTCGCCGTCTCCGGGAACGAGCTGTCGGGGAGGATTCCTCCGGAGCTCGGCGGCCTCACCACCCTCAGGGAGCTCTACATTGGCTACTACAACAGCTACTCCAGCGGCCTACCCCCGGAGCTCGGCAACATGACGGATCTCGTCCGCCTCGACGCCGCCAACTGCGGGCTCTCCGGCGAGATTCCGCCGGAGCTCGGGAACCTCGCCAACCTCGACACGCTCTTCCTGCAGGTGAACGGGCTCGCCGGCGCCATCCCGCCGGAGCTGGGCCGGCTCAAGAGCCTCAGCTCGCTCGACCTGTCCCACAACGCGCTCACCGGCGAGATCCCAGCGAGCTTCGCGGCGCTCA


Protein sequences

Name Description Sequence
Zm.140543 translated coding region predicted by ESTScan from UniGene Zm.140543

XAGSDADALLAAKAVLSDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLDLAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGNFFSGEIPPEYGRWRRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSHNALTGEIPASFAALX


Domains

Domain Start-End Description Sequence

Seg: seg
1-18 seg

XAGSDADALLAAKAVLSD

HMMPanther: PTHR24420
2-281 FAMILY NOT NAMED,FAMILY NOT NAMED

AGSDADALLAAKAVLSDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLDLAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGNFFSGEIPPEYGRWRRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSHNALTGEIPA

HMMPanther: PTHR24420:SF462
2-281 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AGSDADALLAAKAVLSDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLDLAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGNFFSGEIPPEYGRWRRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSHNALTGEIPA

HMMPfam: PF08263
IPR013210
3-43 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

GSDADALLAAKAVLSDPAGALASWTNATSTGACAWSGVTCN

superfamily: SSF52058
4-286 L domain-like,LRR

SDADALLAAKAVLSDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLDLAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGNFFSGEIPPEYGRWRRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSHNALTGEIPASFAAL

Gene3D: G3DSA:3.80.10.10
5-286 no description

DADALLAAKAVLSDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLDLAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGNFFSGEIPPEYGRWRRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSHNALTGEIPASFAAL

Seg: seg
65-82 seg

ALSRLAHLARLDLAANAL

HMMPfam: PF13855
95-152 LRR_8,Leucine rich repeat

SLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGN

FPrintScan: PR00019
96-109 LEURICHRPT,Leucine-rich repeat signature

LTHLNLSNNVLNGT

Seg: seg
111-121 seg

PPPLARLRALR

Seg: seg
130-144 seg

LTGPLPLAVVGLPVL

HMMPfam: PF00560
IPR001611
167-189 LRR_1
Leucine-rich repeat

RLQYLAVSGNELSGRIPPELGGL

HMMPfam: PF00560
IPR001611
217-238 LRR_1
Leucine-rich repeat

LVRLDAANCGLSGEIPPELGNL

FPrintScan: PR00019
262-275 LEURICHRPT,Leucine-rich repeat signature

LKSLSSLDLSHNAL

HMMPfam: PF13516
262-284 LRR_6,Leucine Rich repeat

LKSLSSLDLSHNALTGEIPASFA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox