PRGDB00064654 (Aan.185)

From PRG Wiki
Jump to: navigation, search
Aan.185
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159023889 (EX980254)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Artemisia annua

Comment?

CAIZ874.fwd CAIZ Artemisia annua leaf Artemisia annua cDNA clone CAIZ874 5', mRNA sequence

DNA Sequence

GAATAATAAGTTGTTGTGTGGTGAGCCGTTAGGTAACTGTACGGAACCGAGGTTACCGGGAGTAGGTGAAAGTGAAGGTGAAGGTGATGGTAAGCCGGCGAGTACGGTGGTGGCGTCGTCGCCGGGTTCAATGCCGTCAACGGCGTCGTTACCGTTAAGCCGGAAAAAGTCCGGTGGTGGTAAGATTAGTACGGCGGCGATAGTGGCGATTATAGTCGGAGATGTGGTGGTGTTAGGGTTAGTTTCGTTGATTTTATATTGTTATTTCTGGCGGAATCATAACGGAAAGTCAAAGTCAAAGTCAACGGGTCATGGTCAGATTCTAGAAGGTGAAAAAATAGTTTATTCGTCGAGTCCGTACCCGAACTTGAACCCGGTAGGGAGCGTGAATACCGGGTTCGAGAGGGGTAGGATGGTCTTTTTCGAAGGTGCGAGGAAATTTGAGCTGGAGGATTTGTTGAGAGCGAGTGCGGAGATGTTGGGGAAAGGCGGTTTTGGGACCGCGTATAAGGCGGTATTAGATGATGGAAATGTGGTCGCGGTTAAGCGGTTGAAAGAGGCTGCGATTGGTGGGAGGAAAGAGTTCGAGGAACGGATGGATGTGTTGGGGAGGTTAAGGCACGCGAATGTTGTTAGTTTGAAGGCGTATTATTTTGCGCGTGACGAGAAGTTGTTGGTTTACGAGTACATGAGTAACGGCAACTTGTTTTGGCTACTTCATGGAAACAGAGGACCAGGCAGGACACCTCTTGACTGGACCACAAGGTTGAAGGTTGCAGCTGGCGCAGCTAGAGGACTAGTC


Protein sequences

Name Description Sequence
Aan.185 translated coding region predicted by ESTScan from UniGene Aan.185

XNNKLLCGEPLGNCTEPRLPGVGESEGEGDGKPASTVVASSPGSMPSTASLPLSRKKSGGGKISTAAIVAIIVGDVVVLGLVSLILYCYFWRNHNGKSKSKSTGHGQILEGEKIVYSSSPYPNLNPVGSVNTGFERGRMVFFEGARKFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKEAAIGGRKEFEERMDVLGRLRHANVVSLKAYYFARDEKLLVYEYMSNGNLFWLLHGNRGPGRTPLDWTTRLKVAAGAARGLV

Domains

Domain Start-End Description Sequence

Seg: seg
66-86 seg

AAIVAIIVGDVVVLGLVSLIL

HMMPanther: PTHR24420
68-267 FAMILY NOT NAMED,FAMILY NOT NAMED

IVAIIVGDVVVLGLVSLILYCYFWRNHNGKSKSKSTGHGQILEGEKIVYSSSPYPNLNPVGSVNTGFERGRMVFFEGARKFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKEAAIGGRKEFEERMDVLGRLRHANVVSLKAYYFARDEKLLVYEYMSNGNLFWLLHGNRGPGRTPLDWTTRLKVAAGAARGL

HMMPanther: PTHR24420:SF923
68-267 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

IVAIIVGDVVVLGLVSLILYCYFWRNHNGKSKSKSTGHGQILEGEKIVYSSSPYPNLNPVGSVNTGFERGRMVFFEGARKFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKEAAIGGRKEFEERMDVLGRLRHANVVSLKAYYFARDEKLLVYEYMSNGNLFWLLHGNRGPGRTPLDWTTRLKVAAGAARGL

superfamily: SSF56112
IPR011009
125-267 Protein kinase-like (PK-like)
Protein kinase-like domain

NPVGSVNTGFERGRMVFFEGARKFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKEAAIGGRKEFEERMDVLGRLRHANVVSLKAYYFARDEKLLVYEYMSNGNLFWLLHGNRGPGRTPLDWTTRLKVAAGAARGL

ProfileScan: PS50011
IPR000719
155-268 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKEAAIGGRKEFEERMDVLGRLRHANVVSLKAYYFARDEKLLVYEYMSNGNLFWLLHGNRGPGRTPLDWTTRLKVAAGAARGLV

Gene3D: G3DSA:3.30.200.20
158-216 no description

AEMLGKGGFGTAYKAVLDDGNVVAVKRLKEAAIGGRKEFEERMDVLGRLRHANVVSLKA

HMMPfam: PF07714
IPR001245
159-267 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EMLGKGGFGTAYKAVLDDGNVVAVKRLKEAAIGGRKEFEERMDVLGRLRHANVVSLKAYYFARDEKLLVYEYMSNGNLFWLLHGNRGPGRTPLDWTTRLKVAAGAARGL

PatternScan: PS00107
IPR017441
161-183 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGGFGTAYKAVLDDGNVVAVK

Gene3D: G3DSA:1.10.510.10
217-267 no description

YYFARDEKLLVYEYMSNGNLFWLLHGNRGPGRTPLDWTTRLKVAAGAARGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox