PRGDB00064655 (Aan.187)

From PRG Wiki
Jump to: navigation, search
Aan.187
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259558805 (EZ172070)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig31476, mRNA sequence

DNA Sequence

CAGTTCTCTTTGCATTGTATACCTTGTCAATGTCTGGGTGTCATTGATCTGGTGTTCAGTATAAATAAGGCTGCGAAGCCCACCCATCAGAAGTGTACTGATCTTTTGCTTATGCGTCAAGAAAGTTGAGGGTGGATTCAGCTAAGATCAGGCAGGCTGATAGTTTATTTTTTTATCTAGTTATTATAGTTTTCTAGAGGTTAAGTCCGTTATTTCTTCTTCTACGTGTGTGTCTCTTCTTCGTAAATAAGGTGCTACAAGCAGTTGCATATCAAAAAATGGAAAGGTACAAGATAATTAAGGAAGTTGGTAATGGAAGTTTTGGGGTTGTTTGGCGAGCATTAAATAAGCAGAATGGTGAAGTGGTTGCAATTAAGAAAATGAAGAGGAAGTATTATTCATGGGAAGAGTGCATAAATTTGAGAGAAGTCAAGTCACTGCGTAAGATGAATCATCCAAATGTTGTGAAGCTCAAGGAAGTCATCAGGGAAAATGACATTTTGTACTTTGTATTTGAGTATATGGAATGCAGTCTCTACCAACTTATGAAAGATAGAGTGAAGCTTTTCTTGGAAAGTGAAATTAAAAACTGGTGCTTTCAAGTGTTCCAAGGTCTTGCATACATGCATCAGCGTGGTTACTTCCATCGTGACCTTAAGCCTGAGAACTTTCTTGTTACCAAGGATGTAATAAAAATAGCTGATTTTGGTCTTGCTCGTGAGATCGTTTCCCAACCACCATACACCGAGTATGTTTCAACACGCTGGTATCGTGCTCCTGAGGTTCTTCTCCAGTCACCAACATATGGTTCTGCAGTTGATATGTGGGCAATGGGAGCAATAATGGCCGAATTGTTTACTCTTCGACCACTTTTTCCAGGTTCAAGTGAAGCAGATGAGATCTATAAAATTTGCAGTGTGATAGGCAGTCCAACAAAAAGCTCATGGGCTGAGGGACTTGCGCTTGCACGTGGTATCAATTATCAGTTTCCAGAGCTTGCTGGCGTAAAACTTTCTGCACTGGTACCATCTGCAAGCAAGGATGCAGTTAATCTAATTGCATTACTTTGTTCGTGGGATCCGTGTAAGAGGCCAACAGCATCTGAAGTTCTTCAGCATCCTTTCTTCCAGAGTTGCTACTATGTTCCACCTTCTCTTCGCCCTAAATCTACTGTTGCGAGCCCTAAATCTACCATTTCTAGGACGCCTCCACCTGCTGGAATAAGCGGGAGGAAGGTTGTGGAGCAGAAATGTGCCAAGAAGTTACCCGGAACTTTGCCTAACTCAAAGCCAGCTGGCACCATTATAACATCTGCCAAAATGCATTCATCACTAAATTCAGGCGTTCAACGTAGATTGGAAATGAATCGACAGGATGGAGCAAATGACAAGACAAATAAGAATGCTGCCAGGCAACCAAAATACCAACCACCCATCAAAAACAGTCCAAGAGGAATGTACATGGGGAAGGGGAGAGGCGTTGGCGACACAACTGAAAAGCTGGGAAATATGACACTTAGCACAGGAAGAGTTGGTGCACCCAAGCAGGTGCATCCACCACTACAAATGAAAGCCGGAGTGACAAATACTAGATCTGACTTGTATAATGGAAGATCTCAAGGATATAGCAGTAAGGTGGCTGGATGACCACATTATACCCTACGGTTCTACAAAAATGTGTGCTTTTGTAAGAAAAGTCGTGTTCTAGTGTGAGTATGTTACATGGTCTGATCTTTAAACCATATAGTGGGGGGAGGGTCTAGTAATAAGTGTTTTGGGTATACTTTTTAACGGTGTTTGTCTGTCTTATTGGTCCTATTTTACTGTGTTTCTTACATCGTGTGGGAACTTTCTTATACTGCGTGTTTGACTAACAAGGAACTTCAGTATTTTATACATGAAATGACACAGAACATTTAGCTGATTCTTGTACG


Protein sequences

Name Description Sequence
Aan.187 translated coding region predicted by ESTScan from UniGene Aan.187

MERYKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYMECSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFFQSCYYVPPSLRPKSTVASPKSTISRTPPPAGISGRKVVEQKCAKKLPGTLPNSKPAGTIITSAKMHSSLNSGVQRRLEMNRQDGANDKTNKNAARQPKYQPPIKNSPRGMYMGKGRGVGDTTEKLGNMTLSTGRVGAPKQVHPPLQMKAGVTNTRSDLYNGRSQGYSSKVAG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24055
1-289 FAMILY NOT NAMED,MITOGEN-ACTIVATED PROTEIN KINASE

MERYKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYMECSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFFQSCYYV

HMMPanther: PTHR24055:SF115
1-289 SUBFAMILY NOT NAMED

MERYKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYMECSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFFQSCYYV

Gene3D: G3DSA:3.30.200.20
2-83 no description

ERYKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYME

superfamily: SSF56112
IPR011009
2-314 Protein kinase-like (PK-like)
Protein kinase-like domain

ERYKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYMECSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFFQSCYYVPPSLRPKSTVASPKSTISRTPPPAG

ProfileScan: PS50011
IPR000719
4-283 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYMECSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFF

HMMPfam: PF00069
IPR017442
4-283 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYMECSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFF

HMMSmart: SM00219
IPR020635
4-283 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYMECSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFF

HMMSmart: SM00220
IPR002290
4-283 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YKIIKEVGNGSFGVVWRALNKQNGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNVVKLKEVIRENDILYFVFEYMECSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFF

PatternScan: PS00107
IPR017441
10-34 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGNGSFGVVWRALNKQNGEVVAIKK

Gene3D: G3DSA:1.10.510.10
84-284 no description

CSLYQLMKDRVKLFLESEIKNWCFQVFQGLAYMHQRGYFHRDLKPENFLVTKDVIKIADFGLAREIVSQPPYTEYVSTRWYRAPEVLLQSPTYGSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGSPTKSSWAEGLALARGINYQFPELAGVKLSALVPSASKDAVNLIALLCSWDPCKRPTASEVLQHPFFQ

PatternScan: PS00108
IPR008271
121-133 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

YFHRDLKPENFLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox