PRGDB00064656 (Aan.191)

From PRG Wiki
Jump to: navigation, search
Aan.191
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159603332 (EY077526)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI12843.rev CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI12843 3', mRNA sequence

DNA Sequence

AATCTAAAACAAAAGACAAACAGCAATTATGTACTAATTTAACAGAAAACACATTCTATGCCTCTATGGTCTCAACTTTGTAGAGATTTACCATCGATTAATACCAATATGAAGAGAATTTAAGAACCTACTAAACTACGTATTTTGACCCAACAGGGCCCTGTTGAAAATATAAAATAAGTTTCTAATGTGCTTGCACTTTTGGTGGAACCCTTGAGGTTATAATGCGTAGCTGGTTAGCTATTTCCGTGAAGCTTGGCCTCTCTGATGGCTCTGCTGACCAGCACCTCTCCATCAAAGATCTCCATTCAGGGTCGCATGATTCTGGAACTGCAGGTCTAAGTGTGTTGCTCACAATCCCACCAATAATAGCCCCATAATGCAAGTCTGCATATGGTTCATCTCCAGTAAGAAGTTCCCACATCACAATGCCAAATGAAAAGACATCGACCTTCTCGGAAACAAGGCTACTGCTGCCATTTAGAAGCTCTGGTGCCATCCATGGAAGTGTTCCACGCACACCACCTGAGATTAGCGTTTGACGTTTCACTTTCGATAACCCCAAGTCCCCAACCTTACATACTGGACGGTGTGTATCACGGAGATTGACAAGTAAGTTGTCACTTTTCAGATCGAAGTGTACAATGTTCTTTTCATGAAGGTATTCCATCCCAAAAGCAACATCCATGGCAATTAACAGACGTTTTCGCTTATCCAGATTCCTCTCATTCTTTTGCAAAGCAGTTCTAAGAGAGCCATTAACCATGAACTCTGTAACCGTAGCAACTG


Protein sequences

Name Description Sequence
Aan.191 translated coding region predicted by ESTScan from UniGene Aan.191

XVATVTEFMVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQLRIITSRVPPKVQAH

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-189 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XVATVTEFMVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQLRI

HMMSmart: SM00220
IPR002290
1-190 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XVATVTEFMVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQLRII

HMMPanther: PTHR23257:SF393
2-195 SUBFAMILY NOT NAMED

VATVTEFMVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQLRIITSRVP

HMMSmart: SM00219
IPR020635
2-187 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VATVTEFMVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQL

HMMPanther: PTHR23257
2-195 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VATVTEFMVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQLRIITSRVP

HMMPfam: PF07714
IPR001245
4-187 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

TVTEFMVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQL

superfamily: SSF56112
IPR011009
5-191 Protein kinase-like (PK-like)
Protein kinase-like domain

VTEFMVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQLRIIT

FPrintScan: PR00109
IPR001245
6-19 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEFMVNGSLRTALQ

Gene3D: G3DSA:1.10.510.10
9-192 no description

MVNGSLRTALQKNERNLDKRKRLLIAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDTHRPVCKVGDLGLSKVKRQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGDEPYADLHYGAIIGGIVSNTLRPAVPESCDPEWRSLMERCWSAEPSERPSFTEIANQLRIITS

FPrintScan: PR00109
IPR001245
43-61 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHEKNIVHFDLKSDNLLV

PatternScan: PS00108
IPR008271
49-61 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHFDLKSDNLLV

FPrintScan: PR00109
IPR001245
114-136 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVFSFGIVMWELLTGDEPYADL

FPrintScan: PR00109
IPR001245
158-180 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDPEWRSLMERCWSAEPSERPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox