PRGDB00064658 (Aan.392)

From PRG Wiki
Jump to: navigation, search
Aan.392
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259731684 (EZ180433)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig3909.Ac mRNA sequence

DNA Sequence

CCGACTATTTGGNNNTTTTTTTCGTACTNCCGAAGGCCAACGTAATAGGACCGAAATCATATGATGTTATCCCATGCTACTCGGGTCAGAGCGTAAGCTAGTGATGCTTTCGGCTACTGGACTTTCGCCATCTAGGGTGCAGCATTCTACTGCTTCGCCTAGCAGCACGACGCTTGTATTGCTCTCCCACAACCCCGTTTTCACGGTTTAGGCTGCTCCCATTTCGCTCGCGCGATCCTGTTACTGTCAAAAAATATGCTAGACGCGCTCAATTGGGGGAAATTTTTGAATTAGATCGTGCTACTTTGAAATCCGATGGTGTTCTTCGTAGCAGTCCGANGGGTTGGTTTACTTTTGGACATGCTTCATTTGCTTTACTCTTCTTCTTCGGACACATTTGGCATGGTGCTCCAACTTTGTTTAGCCCAAGACCCAAGCTTAAATTGTACCTCTTCCATCCCCTTCTAACAACTTCAGAACTATCGATGTATGGAGGAACAACCACCGCAGTAACCGTGTCGCTGAACCATTCCTCTTTTGCAGTGCAGTTTTTCAGCCCCCATGCTTCGACAGCCAACCTAGTGGCCGTGCCAAGACGAGCGTGCCTTGCAATGACATTATCCAATCCTTCTTCAAAGATGAGATCAAGAGCTGCTTTAAGACCATACAAAAGTTGAATGGATGGAGTGTAAGGCCAATATGTCCCCATCTTGTAGAATTTCAAGTAGTCCTTCCAATCGAAGAAAACTCTAACTGATTTTGCAGTTTGAGAAGCTTCAATAGCTTTGGGGCTGGCACACACAATCCCCATACCAGTTGGAAGAGAAAGTGCTTTCTGAGAGCCGGTTAAAGCAACATCAACACCCCATTCATCCATACGGAAATCCAAAGCACATATGGATGACACACCATCAACTAGAAAGAGGGCTGGATGTTGGTAGTGATCAAGAATTTTCCTTACGGAAGCCAAGTTGTTAGTAACTCCTGTTGCTGTCTCGTTGTGAACGATGCAGATGGCCTTAATAGTATGAGCCGAATCTGCAGCCAGTTTTGATGCTAGGACTTCCAAGTCAGCACCATGGCCCCATTCACTTTCCACCACATCAACATTGTAGCCAAGGCGTTGCTGCTGATCAACC


Protein sequences

Name Description Sequence
Aan.392 translated coding region predicted by ESTScan from UniGene Aan.392

XVDQQQRLGYNVDVVESEWGHGADLEVLASKLAADSAHTIKAICIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHARLGTATRLAVEAWGLKNCTAKEEWFSDTVTAVVVPPYIDSSEVVRRGWKRYNLSLGLGLNKVGAPCQMCPKKKSKANEACPKVNQPXGLLRRTPSDFKVARSNSKISPNXARLAYFLTVTGSRERNGSSLNRENGVVGEQYKRRAAREAVECCTLDGESPVAESITSLRSDPSSMG

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
2-242 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

VDQQQRLGYNVDVVESEWGHGADLEVLASKLAADSAHTIKAICIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHARLGTATRLAVEAWGLKNCTAKEEWFSDTVTAVVVPPYIDSSEVVRRGWKRYNLSLGLGLNK

HMMPanther: PTHR21152
3-243 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

DQQQRLGYNVDVVESEWGHGADLEVLASKLAADSAHTIKAICIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHARLGTATRLAVEAWGLKNCTAKEEWFSDTVTAVVVPPYIDSSEVVRRGWKRYNLSLGLGLNKV

HMMPanther: PTHR21152:SF7
3-243 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DQQQRLGYNVDVVESEWGHGADLEVLASKLAADSAHTIKAICIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHARLGTATRLAVEAWGLKNCTAKEEWFSDTVTAVVVPPYIDSSEVVRRGWKRYNLSLGLGLNKV

Gene3D: G3DSA:3.40.640.10
IPR015421
4-159 no description
Pyridoxal phosphate-dependent transferase, major r

QQQRLGYNVDVVESEWGHGADLEVLASKLAADSAHTIKAICIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLY

HMMPfam: PF00266
IPR000192
5-225 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

QQRLGYNVDVVESEWGHGADLEVLASKLAADSAHTIKAICIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHARLGTATRLAVEAWGLKNCTAKEEWFSDTVTAVVVPPYIDSSEVV

PatternScan: PS00595
IPR020578
94-114 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGMGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
160-243 no description
Pyridoxal phosphate-dependent transferase, major r

GLKAALDLIFEEGLDNVIARHARLGTATRLAVEAWGLKNCTAKEEWFSDTVTAVVVPPYIDSSEVVRRGWKRYNLSLGLGLNKV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox