PRGDB00064659 (Aan.405)

From PRG Wiki
Jump to: navigation, search
Aan.405
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259720586 (EZ195800)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig9357.Aml mRNA sequence

DNA Sequence

CTTTAATTCATGTTAGTTTCACTTATTGTTTAACAGTTCATAACTTACTCACAATAGCTAGTTTATATATATACCGAGTCAACTCAGTTGGTGGATCGGGTTCTTGTTGTTGAGTTCATTGATTGATTAGTTTACACGTTGATTTCGAAGAAAATAGATTCGAAGGGTTGGCCTTGGTGTTTTTTGTATATACAAACATGATGGAGGTTTTTAGGCTAGAGAAGCATAGGTTGCTGAGTTTGGGTTTGATCATATGTTTGCTGTATCAGAATTTGAGTTTCTGCTGTGGTTTTAATGATGAAGGTTTTTCTATAACAAGATTTAGATATGATATTGGAGTACATAATCCGTGTTCATGGTTTGGTTTTGACTGCTCCAAGGGATATGTTTTATCTTTGAACATTGGCAGAACTGGATTAAAGTCCCACCGGAAACTGCTTGACGAGAATGTAGAAGTACAGCCGCCATTGGTCCCATTTCCGCTACCAGCATCGCCATCGCCTTCACCATCACTGTCACCATCTCCATCTCCAACAGTAGCACCTGTGCCATCACCATCTCCTTCTTCTCTACTACCTCCGCCTTCAACCGTTGCTCAAGCTCCTCCCGCACTCGCAGATCCTCCACCTGCCCTTCCTTTCCTACCATCTGCTGGACAAAGTTCAAGGAAGAAAAACCATCTTGCTTTAGTATTATCTATTACTCTTGGAGCCACTGCATTAGTTGGAATTGTAGCATTATTGCTATGGAGAGGCAATAAAGTCGCCACTGTTAGGCCTTGGGCCACTGGACTAAGTGGCCAATTACAAAAAGCTTTTGTTACTGGGGTTCCAAAGCTAAAAAGATCAGAGCTTGAGGCAGCTTGTGAAGATTTTAGCAATGTAATCGGTTCAACATCGTTTGGGACTGTATATAAAGGGACGTTATCTAGTGGGGTTGAAATAGCAGTTGCTTCTGTGGCTGCACCTTCCGCTAAAGAGTGGTCAAAGCATCTTGAAAGCTCGTTTCGGAAGAGGATTGACATGTTATCGAAGGTGAACCACAAGAATTTTGTGAACCTTCTTGGTTTTTGCGAGGAAGATGAACCTTTTACCAGAATGATAGCGTTCGAATATGCTCCTAATGGAACACTCTTTGAACATCTACATATACAAGAATCAGAACATTTGGACTGGATGATGAGGATGAGAATCGTAATGGGAATGTCATACTGTCTCGACTACATGCATCAACTAACTCCACCCATTGCCCACAAAAACCTAAACTCTTCATCAGTAAACTTAACCGAAGACTACGCAGCAAAAACATCAGATTTCGGCCTATGCAACGATGCATCAACTGCAAACACTGACAAACTCCTGAAAGTAACGTTTACNGCTTTGGTA


Protein sequences

Name Description Sequence
Aan.405 translated coding region predicted by ESTScan from UniGene Aan.405

MMEVFRLEKHRLLSLGLIICLLYQNLSFCCGFNDEGFSITRFRYDIGVHNPCSWFGFDCSKGYVLSLNIGRTGLKSHRKLLDENVEVQPPLVPFPLPASPSPSPSLSPSPSPTVAPVPSPSPSSLLPPPSTVAQAPPALADPPPALPFLPSAGQSSRKKNHLALVLSITLGATALVGIVALLLWRGNKVATVRPWATGLSGQLQKAFVTGVPKLKRSELEAACEDFSNVIGSTSFGTVYKGTLSSGVEIAVASVAAPSAKEWSKHLESSFRKRIDMLSKVNHKNFVNLLGFCEEDEPFTRMIAFEYAPNGTLFEHLHIQESEHLDWMMRMRIVMGMSYCLDYMHQLTPPIAHKNLNSSSVNLTEDYAAKTSDFGLCNDASTANTDKLLKVTFTALV

Domains

Domain Start-End Description Sequence

Seg: seg
12-22 seg

LLSLGLIICLL

Seg: seg
89-132 seg

PPLVPFPLPASPSPSPSLSPSPSPTVAPVPSPSPSSLLPPPSTV

HMMPanther: PTHR24420:SF810
104-375 SUBFAMILY NOT NAMED

PSLSPSPSPTVAPVPSPSPSSLLPPPSTVAQAPPALADPPPALPFLPSAGQSSRKKNHLALVLSITLGATALVGIVALLLWRGNKVATVRPWATGLSGQLQKAFVTGVPKLKRSELEAACEDFSNVIGSTSFGTVYKGTLSSGVEIAVASVAAPSAKEWSKHLESSFRKRIDMLSKVNHKNFVNLLGFCEEDEPFTRMIAFEYAPNGTLFEHLHIQESEHLDWMMRMRIVMGMSYCLDYMHQLTPPIAHKNLNSSSVNLTEDYAAKTSDFGL

HMMPanther: PTHR24420
104-375 FAMILY NOT NAMED,FAMILY NOT NAMED

PSLSPSPSPTVAPVPSPSPSSLLPPPSTVAQAPPALADPPPALPFLPSAGQSSRKKNHLALVLSITLGATALVGIVALLLWRGNKVATVRPWATGLSGQLQKAFVTGVPKLKRSELEAACEDFSNVIGSTSFGTVYKGTLSSGVEIAVASVAAPSAKEWSKHLESSFRKRIDMLSKVNHKNFVNLLGFCEEDEPFTRMIAFEYAPNGTLFEHLHIQESEHLDWMMRMRIVMGMSYCLDYMHQLTPPIAHKNLNSSSVNLTEDYAAKTSDFGL

Seg: seg
133-152 seg

AQAPPALADPPPALPFLPSA

superfamily: SSF56112
IPR011009
215-376 Protein kinase-like (PK-like)
Protein kinase-like domain

KRSELEAACEDFSNVIGSTSFGTVYKGTLSSGVEIAVASVAAPSAKEWSKHLESSFRKRIDMLSKVNHKNFVNLLGFCEEDEPFTRMIAFEYAPNGTLFEHLHIQESEHLDWMMRMRIVMGMSYCLDYMHQLTPPIAHKNLNSSSVNLTEDYAAKTSDFGLC

Gene3D: G3DSA:3.30.200.20
215-287 no description

KRSELEAACEDFSNVIGSTSFGTVYKGTLSSGVEIAVASVAAPSAKEWSKHLESSFRKRIDMLSKVNHKNFVN

ProfileScan: PS50011
IPR000719
224-396 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EDFSNVIGSTSFGTVYKGTLSSGVEIAVASVAAPSAKEWSKHLESSFRKRIDMLSKVNHKNFVNLLGFCEEDEPFTRMIAFEYAPNGTLFEHLHIQESEHLDWMMRMRIVMGMSYCLDYMHQLTPPIAHKNLNSSSVNLTEDYAAKTSDFGLCNDASTANTDKLLKVTFTALV

HMMSmart: SM00219
IPR020635
224-396 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EDFSNVIGSTSFGTVYKGTLSSGVEIAVASVAAPSAKEWSKHLESSFRKRIDMLSKVNHKNFVNLLGFCEEDEPFTRMIAFEYAPNGTLFEHLHIQESEHLDWMMRMRIVMGMSYCLDYMHQLTPPIAHKNLNSSSVNLTEDYAAKTSDFGLCNDASTANTDKLLKVTFTALV

HMMPfam: PF07714
IPR001245
226-382 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FSNVIGSTSFGTVYKGTLSSGVEIAVASVAAPSAKEWSKHLESSFRKRIDMLSKVNHKNFVNLLGFCEEDEPFTRMIAFEYAPNGTLFEHLHIQESEHLDWMMRMRIVMGMSYCLDYMHQLTPPIAHKNLNSSSVNLTEDYAAKTSDFGLCNDASTA

Gene3D: G3DSA:1.10.510.10
288-383 no description

LLGFCEEDEPFTRMIAFEYAPNGTLFEHLHIQESEHLDWMMRMRIVMGMSYCLDYMHQLTPPIAHKNLNSSSVNLTEDYAAKTSDFGLCNDASTAN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox