PRGDB00064660 (Aan.539)

From PRG Wiki
Jump to: navigation, search
Aan.539
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259788240 (EZ301039)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Madagascar Contig6924.Blm mRNA sequence

DNA Sequence

GCACTGTAGTTTTACATGAACAAATCATAAGATAGcaaaaactaacaacacaaattcacacattcaattcatctcacaaaaacacacaaGCAAGCCATTACAATGTAGGCAATCAGAAGTTTCAAAATGCAATTCATCTTCACATGAAGTTTCCCCTCTTTAATCAGCTCCCTACACTTCTTACCAACTTGAGTAAAATAATTATACGAAAGGGTAAAATTCGACAAGTGTGGTAAGCAACAAACCGCCTCCGGTACAACCCCAGAGAAACGATTATGAGCCAAATTTAACAGCTCCATTTCCTCTAAACACTGAAACGAATGAGGGATAGGACCCATTAAACGATTAAAACCAACATCAAACACCTGAGCTTTCTTCAAATACCCGATTTCATAAGGCAAACAACCAGTTAACTGATTGTTCAAGAACAAAACCTCCATTAAAGTATTATTAGCTAAGCGAATACTCGTAGGTATCCCACCAATAAATTTATTATTTGCCAAGACTAAATAAAGCGCGGGCGTGTTTCCGAGGGTGTCGGGAATCTTTTGGGGGACGAGGTTATTGTTGTTTATAAATAGCAAGTCGAGGTCAAGAGTGAATATTTGAGGTGGAACAAAGCCCTCGAATTTGTTGAACCGCAGGTCGAGAAAAAGTAATTGCTTAGCAGCTAGGACTTGGTTCGGGAACGGGCCCGAAAGTTGGTTGTTACTAAGGTCGAGTTCGAAGAAATATTTTAGTTTGCTAGCATCGGCTGGGATGGTACCTGTGAAGTTGTTTGAATTTGCATGGAAGAATACTATGTCTGTTAAACCTACGAGGATTTCGTTAAAGGGTAGATCGTCGTGAAAACCAGCAAAGCCTGCGTTGTTAAAGTTTACGCCTGACATAGTCCtttttttttGCCCGGGTACGGTGTCGCATTTGAAGCCTCTGTATTTGCAAACATTGGGACCGTTCCATGTTTTTTAAAGCCTTTGGGATCGATCATTAATTTTCTTTTTGAATCTCTGGATTCTACAGTGC


Protein sequences

Name Description Sequence
Aan.539 translated coding region predicted by ESTScan from UniGene Aan.539

MSGVNFNNAGFAGFHDDLPFNEILVGLTDIVFFHANSNNFTGTIPADASKLKYFFELDLSNNQLSGPFPNQVLAAKQLLFLDLRFNKFEGFVPPQIFTLDLDLLFINNNNLVPQKIPDTLGNTPALYLVLANNKFIGGIPTSIRLANNTLMEVLFLNNQLTGCLPYEIGYLKKAQVFDVGFNRLMGPIPHSFQCLEEMELLNLAHNRFSGVVPEAVCCLPHLSNFTLSYNYFTQVGKKCRELIKEGKLHVKMNCILKLLIAYIVMACLCVFVR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-245 FAMILY NOT NAMED,FAMILY NOT NAMED

MSGVNFNNAGFAGFHDDLPFNEILVGLTDIVFFHANSNNFTGTIPADASKLKYFFELDLSNNQLSGPFPNQVLAAKQLLFLDLRFNKFEGFVPPQIFTLDLDLLFINNNNLVPQKIPDTLGNTPALYLVLANNKFIGGIPTSIRLANNTLMEVLFLNNQLTGCLPYEIGYLKKAQVFDVGFNRLMGPIPHSFQCLEEMELLNLAHNRFSGVVPEAVCCLPHLSNFTLSYNYFTQVGKKCRELIKE

HMMPanther: PTHR24420:SF937
1-245 SUBFAMILY NOT NAMED

MSGVNFNNAGFAGFHDDLPFNEILVGLTDIVFFHANSNNFTGTIPADASKLKYFFELDLSNNQLSGPFPNQVLAAKQLLFLDLRFNKFEGFVPPQIFTLDLDLLFINNNNLVPQKIPDTLGNTPALYLVLANNKFIGGIPTSIRLANNTLMEVLFLNNQLTGCLPYEIGYLKKAQVFDVGFNRLMGPIPHSFQCLEEMELLNLAHNRFSGVVPEAVCCLPHLSNFTLSYNYFTQVGKKCRELIKE

Gene3D: G3DSA:3.80.10.10
21-256 no description

NEILVGLTDIVFFHANSNNFTGTIPADASKLKYFFELDLSNNQLSGPFPNQVLAAKQLLFLDLRFNKFEGFVPPQIFTLDLDLLFINNNNLVPQKIPDTLGNTPALYLVLANNKFIGGIPTSIRLANNTLMEVLFLNNQLTGCLPYEIGYLKKAQVFDVGFNRLMGPIPHSFQCLEEMELLNLAHNRFSGVVPEAVCCLPHLSNFTLSYNYFTQVGKKCRELIKEGKLHVKMNCIL

superfamily: SSF52058
24-256 L domain-like,LRR

LVGLTDIVFFHANSNNFTGTIPADASKLKYFFELDLSNNQLSGPFPNQVLAAKQLLFLDLRFNKFEGFVPPQIFTLDLDLLFINNNNLVPQKIPDTLGNTPALYLVLANNKFIGGIPTSIRLANNTLMEVLFLNNQLTGCLPYEIGYLKKAQVFDVGFNRLMGPIPHSFQCLEEMELLNLAHNRFSGVVPEAVCCLPHLSNFTLSYNYFTQVGKKCRELIKEGKLHVKMNCIL

HMMPfam: PF00560
IPR001611
56-71 LRR_1
Leucine-rich repeat

ELDLSNNQLSGPFPNQ

Seg: seg
96-111 seg

IFTLDLDLLFINNNNL

HMMPfam: PF13855
178-231 LRR_8,Leucine rich repeat

DVGFNRLMGPIPHSFQCLEEMELLNLAHNRFSGVVPEAVCCLPHLSNFTLSYNY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox