PRGDB00064661 (Aan.667)

From PRG Wiki
Jump to: navigation, search
Aan.667
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259743236 (EZ338326)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Uganda Contig5542.Uhm mRNA sequence

DNA Sequence

CGCGCACAAGCCCGATGGCTACTAAGCAATTAAGCCATTTGTTTTAACCCCTCATAAATGGGCTGTGTTTGTTTGTTTGAATCTCTTTAGGGTTCTTTCTTTTTCGTGACTCCCTCCATTCATATAATAAAATCAACGCAACCACATACTTATTCTTATTAGATCAAACCTATCATATCATATCATGgctgctgctgctgctgctTGTGGTAGCTTAGTTGTTGTTTCAGTATTATTAGTTTTATTTACATCGACAGTCAGTGGCAACTCGGAAGGAGACGCGCTGTACGCGCTAAGAAGGAGCTTAAACGATCCAGAGAAAGTGCTGCAAAGCTGGGATCCAAATCTGGTTAATCCTTGCACCTGGTTTCACATCACTTGTAATCAAGACAATCGTGTCACTCGTCTGGATCTTGGAAATTCAAAGTTATCTGGTCATCTTGTGCCTGAACTAGGAAAGCTTGAACATCTACAGTATCTGGAGCTCTACAAAAATAACATCCAAGGTACGATTCCTGCAGAGATCGGTAACTTGAAGAGCCTCATAAGCTTGGATCTCTACAACAACAATATTACTGGCAAAATTCCATCCACACTTGGGAAGTTGAAAAATCTAGTGTTCTTGCGTCTTAATGATAATCGTCTAACTGGAAGAATCCCAAGGGAACTCATTGGCGTTTCAAGCTTGAAAGTGGTGGACGTATCAAACAATAACCTCTGTGGAACAATCCCTACCACCGGTCCATTTGAACACATCCCTTTAAACAACTTTGAGAACAATCCTCTTCTGGAAGGGCCAGAGTTGATGGGACTAGCAAGTTATGACACAAACTGCACGTAGAAGTGTTGTTTCTAGTTGTCTTACATGATGCCAAGTTTGCTGCTCTTATAAACCCGTCTTGAGTTGTAAGAACTCTTGTGAAAACATATAACATCCGGATAGTTTGTTGTGATATTGTCTGTAAAATGTTTATGTTGCTGTGATGTACTATGTCTTGAAAAATATAATATTTGGTGGCAACCAATCGAAGTTATAACCTAAAACGCACTCGTGACTGTTTGAGCTACAAGCTAGTTTGCACTTAAAACGCACTCG


Protein sequences

Name Description Sequence
Aan.667 translated coding region predicted by ESTScan from UniGene Aan.667

MAAAAAACGSLVVVSVLLVLFTSTVSGNSEGDALYALRRSLNDPEKVLQSWDPNLVNPCTWFHITCNQDNRVTRLDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPAEIGNLKSLISLDLYNNNITGKIPSTLGKLKNLVFLRLNDNRLTGRIPRELIGVSSLKVVDVSNNNLCGTIPTTGPFEHIPLNNFENNPLLEGPELMGLASYDTNCT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-208 FAMILY NOT NAMED,FAMILY NOT NAMED

MAAAAAACGSLVVVSVLLVLFTSTVSGNSEGDALYALRRSLNDPEKVLQSWDPNLVNPCTWFHITCNQDNRVTRLDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPAEIGNLKSLISLDLYNNNITGKIPSTLGKLKNLVFLRLNDNRLTGRIPRELIGVSSLKVVDVSNNNLCGTIPTTGPFEHIPLNNFENNPLLEGPELM

HMMPanther: PTHR24420:SF836
1-208 SUBFAMILY NOT NAMED

MAAAAAACGSLVVVSVLLVLFTSTVSGNSEGDALYALRRSLNDPEKVLQSWDPNLVNPCTWFHITCNQDNRVTRLDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPAEIGNLKSLISLDLYNNNITGKIPSTLGKLKNLVFLRLNDNRLTGRIPRELIGVSSLKVVDVSNNNLCGTIPTTGPFEHIPLNNFENNPLLEGPELM

Seg: seg
2-27 seg

AAAAAACGSLVVVSVLLVLFTSTVSG

superfamily: SSF52058
24-211 L domain-like,LRR

TVSGNSEGDALYALRRSLNDPEKVLQSWDPNLVNPCTWFHITCNQDNRVTRLDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPAEIGNLKSLISLDLYNNNITGKIPSTLGKLKNLVFLRLNDNRLTGRIPRELIGVSSLKVVDVSNNNLCGTIPTTGPFEHIPLNNFENNPLLEGPELMGLA

HMMPfam: PF08263
IPR013210
28-67 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

NSEGDALYALRRSLNDPEKVLQSWDPNLVNPCTWFHITCN

Gene3D: G3DSA:3.80.10.10
29-202 no description

SEGDALYALRRSLNDPEKVLQSWDPNLVNPCTWFHITCNQDNRVTRLDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPAEIGNLKSLISLDLYNNNITGKIPSTLGKLKNLVFLRLNDNRLTGRIPRELIGVSSLKVVDVSNNNLCGTIPTTGPFEHIPLNNFENNPLL

HMMPfam: PF12799
95-131 LRR_4,Leucine Rich repeats (2 copies)

HLQYLELYKNNIQGTIPAEIGNLKSLISLDLYNNNIT

HMMPfam: PF00560
IPR001611
143-161 LRR_1
Leucine-rich repeat

NLVFLRLNDNRLTGRIPRE

HMMPfam: PF00560
IPR001611
167-184 LRR_1
Leucine-rich repeat

SLKVVDVSNNNLCGTIPT

Seg: seg
192-207 seg

PLNNFENNPLLEGPEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox