PRGDB00064662 (Aan.696)

From PRG Wiki
Jump to: navigation, search
Aan.696
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159750533 (EY102474)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI25781.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI25781 5', mRNA sequence

DNA Sequence

CAAGAAGATAAGTGTGGCTCCAACAAACGCCATATCATATTCAATAGCCGATCTTCAAATAGCTACAGACAGCTTTAGTGCTGATAACCTTGTTGGGGAGGGGTCTACTGGACGTGTTTACCGTGCTCAATTTGAAGATGGAAAGGTGGTTGCGGTTAAGAAGATAAATTCATCTGTTCTACCTGGCCGCTTGTCAGAAGATTTCATTGATATAGTTTCAGATGTATCAAGGTTACGACATCCAAATGTGACAGAGCTGGTTGGTTATTGCTCCGAGCATGGTCAGCACCTCCTAGTTTATGAGTTCCTCAAGAATGGTTCACTCTATGATTTCCTGCACCTCTCAGATGAATACAGCAAGCCATTAACATGGAATAATCGTGTCAAGATCGCTTTAGGGGCAGCACGCGCATTGGAATATCTACATGAAGTATGCTCACCATCCGTTGTTCATAAAAGTATAAAATCCGCAAACATTTTGCTGGACTCAGAGCTCAATCCTCACCTTTCTGACTGTGGTTTAGCAAGTCTTGTTCCAGATGCAGATCAGGAACTGGACAACAGTGCCCCAGAGGTCTCCATGTCTGGTACATACACAATCAAAAGTGACGTCTATGGTTTCGGTGTCACCATGTTGGAACTACTCACAGGAAGAAAACCATTTGATAGCTCAAGGACAAGAGCTGAGCAGTCTTTGGTGCGATGGGCAACACCTCAACTTCATGACATTGATGCCCTTGCCAAGATGGTTGATCCGGCACTCAAAGGACTCTATCCTGTTAAATCTCTCTCTCGC


Protein sequences

Name Description Sequence
Aan.696 translated coding region predicted by ESTScan from UniGene Aan.696

XKKISVAPTNAISYSIADLQIATDSFSADNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGYCSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSSRTRAEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
10-266 FAMILY NOT NAMED,FAMILY NOT NAMED

NAISYSIADLQIATDSFSADNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGYCSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSSRTRAEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR

HMMPanther: PTHR24420:SF463
10-266 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NAISYSIADLQIATDSFSADNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGYCSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSSRTRAEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR

Gene3D: G3DSA:3.30.200.20
11-90 no description

AISYSIADLQIATDSFSADNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGY

superfamily: SSF56112
IPR011009
15-256 Protein kinase-like (PK-like)
Protein kinase-like domain

SIADLQIATDSFSADNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGYCSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSSRTRAEQSLVRWATPQLHDIDALAKMVDPALK

ProfileScan: PS50011
IPR000719
26-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSADNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGYCSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSSRTRAEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR

HMMSmart: SM00219
IPR020635
26-251 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSADNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGYCSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSSRTRAEQSLVRWATPQLHDIDALAKMV

HMMSmart: SM00220
IPR002290
26-255 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSADNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGYCSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSSRTRAEQSLVRWATPQLHDIDALAKMVDPAL

HMMPfam: PF07714
IPR001245
29-225 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DNLVGEGSTGRVYRAQFEDGKVVAVKKINSSVLPGRLSEDFIDIVSDVSRLRHPNVTELVGYCSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSS

PatternScan: PS00107
IPR017441
32-55 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGSTGRVYRAQFEDGKVVAVKK

Gene3D: G3DSA:1.10.510.10
91-229 no description

CSEHGQHLLVYEFLKNGSLYDFLHLSDEYSKPLTWNNRVKIALGAARALEYLHEVCSPSVVHKSIKSANILLDSELNPHLSDCGLASLVPDADQELDNSAPEVSMSGTYTIKSDVYGFGVTMLELLTGRKPFDSSRTRA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox