PRGDB00064663 (Aan.740)

From PRG Wiki
Jump to: navigation, search
Aan.740
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159191521 (EY033094)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Artemisia annua

Comment?

CAIU758.fwd CAIU Artemisia annua leaf Artemisia annua cDNA clone CAIU758 5', mRNA sequence

DNA Sequence

GGCACACTCGGGTACTTGGCTCCAGAATACGCTATGCTGGGAAAAGCATCAGAAAGTTGTGATGTTTACAGTTTTGGTATACTATTGCTCGAGTTAGCTAGCGGCAAGAAACCAATTGAAAAAGTAAACGCGACAACAAGAAGATCAATCACCGAATGGGCTTTGCCATTAGTTTGTGAAAGAAAGTTTAGTGAAATCGCTGATCCAAAACTAAAAGGGGATTATTCAGCTGAAGAATTGAAAAGGGTTACTCTTATTGGTCTTACATGTGCTCGTAATCAAGCAGAAAAAAGACCGACAATTCTTGAGGTGGTTGAGTTGTTAAAGGGAGAGTCAAAGGAGAAGTTTGCTGCTTTGGAGAACGATGAAATGTTTAGCACTCCACACGCTGCTGATTGTAATGACGGAGTATCCGTTGCAGATGATAGTTCTGACTTTGTTTCGGAAGATAAAGAACGAAATCGAGAAATTGAAAATGTTGGGTCATAGAAGTTGAAGGCCATGGTTGAGTGGTTTGTAAAAAAGGTTGATATTTTTTAGCCATTTGTATTTGCAAGTGATGCAAGTCTATTATGTTATTTGGTTCTTCTTTATTGACCAGTTAGTGTGTGGATATTATTATTTGTGAAGTATTTAATGATTTGTTTTTGAAATTTGGAAATGAAGTATGGATCATGCTTTCT


Protein sequences

Name Description Sequence
Aan.740 translated coding region predicted by ESTScan from UniGene Aan.740

GTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKVNATTRRSITEWALPLVCERKFSEIADPKLKGDYSAEELKRVTLIGLTCARNQAEKRPTILEVVELLKGESKEKFAALENDEMFSTPHAADCNDGVSVADDSSDFVSEDKERNREIENVGS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.10.510.10
1-107 no description

GTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKVNATTRRSITEWALPLVCERKFSEIADPKLKGDYSAEELKRVTLIGLTCARNQAEKRPTILEVVEL

ProfileScan: PS50011
IPR000719
1-117 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKVNATTRRSITEWALPLVCERKFSEIADPKLKGDYSAEELKRVTLIGLTCARNQAEKRPTILEVVELLKGESKEKFA

HMMPfam: PF00069
IPR017442
1-106 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKVNATTRRSITEWALPLVCERKFSEIADPKLKGDYSAEELKRVTLIGLTCARNQAEKRPTILEVVE

superfamily: SSF56112
IPR011009
1-108 Protein kinase-like (PK-like)
Protein kinase-like domain

GTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKVNATTRRSITEWALPLVCERKFSEIADPKLKGDYSAEELKRVTLIGLTCARNQAEKRPTILEVVELL

HMMPanther: PTHR24420
1-160 FAMILY NOT NAMED,FAMILY NOT NAMED

GTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKVNATTRRSITEWALPLVCERKFSEIADPKLKGDYSAEELKRVTLIGLTCARNQAEKRPTILEVVELLKGESKEKFAALENDEMFSTPHAADCNDGVSVADDSSDFVSEDKERNREIENV

HMMPanther: PTHR24420:SF427
1-160 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKVNATTRRSITEWALPLVCERKFSEIADPKLKGDYSAEELKRVTLIGLTCARNQAEKRPTILEVVELLKGESKEKFAALENDEMFSTPHAADCNDGVSVADDSSDFVSEDKERNREIENV

Seg: seg
135-150 seg

DGVSVADDSSDFVSED






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox