PRGDB00064664 (Aan.836)

From PRG Wiki
Jump to: navigation, search
Aan.836
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159191289 (EY033394)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAIW552.rev CAIW Artemisia annua leaf Artemisia annua cDNA clone CAIW552 3', mRNA sequence

DNA Sequence

tttttttttttttttGCTAATACTTGAACCCACAATCTGTCGGTTCTGAAGAATCCATATTCTCGCGGATATCGTTTCATCATGATGTTATCATATACTTTACAGTTTAAAGTAAGAAATTTTATAAACTGTCAACTTAACAAATAAGTCTAAATTATCCACACAAAAGAAAAAATACCAAGAAAGAACAACAGTTTCTAGTCACTGTCACCTATCTTCTCCAATGAGATCAAGAAGAATCAGTCTGGAAGCATCAGTAGGTGACAGGTGTTACAACGGAGTGACTTGTACTTGTACTTGGTGCAGAAGAATCGGTGCCAGAAGTTGTACGAGCACTTTGAAACGTTGTAGAATCAGTAAAATTAAAACCAGTAAGGTACTCAGGGCGAGTAATAACACCAGTTGGTTCTATATCTTCTGAAAGCATTGCTATCACTCGTGACATTGATGGTCGTAGCATAGGTGAGGTTTGTGTGCATAAAAGGGCGACTCTCATCACTTTTCTTACTTCATTCTCGTCGAATTCAGATAATTCTTCATCCACTAACTCAAGTTCATTATTGGCTTCATGTAGGTTCCATGCCCATTCAAGAAGATATACTTTATCATCATCCAAACTCGAATCAGAATTAGGCCTTCCACTGATAATCTCTAAAGCTACCACTCCAAATCCAAACACATCAGCCTTTTCCGTAAGGTGCCCCACGCTTGCATACTCCGGTGCAAGATACCCTATTGTGCCCCC


Protein sequences

Name Description Sequence
Aan.836 translated coding region predicted by ESTScan from UniGene Aan.836

GGTIGYLAPEYASVGHLTEKADVFGFGVVALEIISGRPNSDSSLDDDKVYLLEWAWNLHEANNELELVDEELSEFDENEVRKVMRVALLCTQTSPMLRPSMSRVIAMLSEDIEPTGVITRPEYLTGFNFTDSTTFQSARTTSGTDSSAPSTSTSHSVVTPVTY

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-112 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GGTIGYLAPEYASVGHLTEKADVFGFGVVALEIISGRPNSDSSLDDDKVYLLEWAWNLHEANNELELVDEELSEFDENEVRKVMRVALLCTQTSPMLRPSMSRVIAMLSEDI

Gene3D: G3DSA:1.10.510.10
2-107 no description

GTIGYLAPEYASVGHLTEKADVFGFGVVALEIISGRPNSDSSLDDDKVYLLEWAWNLHEANNELELVDEELSEFDENEVRKVMRVALLCTQTSPMLRPSMSRVIAM

superfamily: SSF56112
IPR011009
2-154 Protein kinase-like (PK-like)
Protein kinase-like domain

GTIGYLAPEYASVGHLTEKADVFGFGVVALEIISGRPNSDSSLDDDKVYLLEWAWNLHEANNELELVDEELSEFDENEVRKVMRVALLCTQTSPMLRPSMSRVIAMLSEDIEPTGVITRPEYLTGFNFTDSTTFQSARTTSGTDSSAPSTSTS

HMMPanther: PTHR24420:SF469
2-162 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GTIGYLAPEYASVGHLTEKADVFGFGVVALEIISGRPNSDSSLDDDKVYLLEWAWNLHEANNELELVDEELSEFDENEVRKVMRVALLCTQTSPMLRPSMSRVIAMLSEDIEPTGVITRPEYLTGFNFTDSTTFQSARTTSGTDSSAPSTSTSHSVVTPVT

HMMPanther: PTHR24420
2-162 FAMILY NOT NAMED,FAMILY NOT NAMED

GTIGYLAPEYASVGHLTEKADVFGFGVVALEIISGRPNSDSSLDDDKVYLLEWAWNLHEANNELELVDEELSEFDENEVRKVMRVALLCTQTSPMLRPSMSRVIAMLSEDIEPTGVITRPEYLTGFNFTDSTTFQSARTTSGTDSSAPSTSTSHSVVTPVT

HMMPfam: PF07714
IPR001245
4-108 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

IGYLAPEYASVGHLTEKADVFGFGVVALEIISGRPNSDSSLDDDKVYLLEWAWNLHEANNELELVDEELSEFDENEVRKVMRVALLCTQTSPMLRPSMSRVIAML

Coil: coil
58-79 coiled-coil

LHEANNELELVDEELSEFDENE

Seg: seg
140-162 seg

TTSGTDSSAPSTSTSHSVVTPVT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox