PRGDB00064665 (Aan.881)

From PRG Wiki
Jump to: navigation, search
Aan.881
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159773123 (EY109785)
Gene Class Mlo-like
Domain Type MLO
Gene Species Artemisia annua

Comment?

CAZI6458.rev CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI6458 3', mRNA sequence

DNA Sequence

GGGTTCAATAAATTGAAATTATACACCATCAGCTGATCCTGAGCTGAGTTGAAACTTATCTAAATACATCATGTATGGAATTGGTACATTAAGTTCAAGTAGCCGTGCAAAATATACTATAATGAACATTATTTACTAACTTTTTTCAAATGAAAAATCCGAAATTTCATCCTCCCGTTGAGTCCTAACTGGTTTCGACCCTGATGGCAATTTGGTTGAGCTTGAGCTTGGTTCTTGAATCTCAATTTCTCTTAATTCATTCACCTCGTCTCTTGATAAGCTTTTGTGTTCTTTGTATTTGTGGGGGTGGGTGGAAGGAAACTCATTGGCCCAACCTTCGTGTTCAAAATCAGAGCCTCTTGGAGAATTTGAAGGACTATCGAGACTATCCTCCGGGTGTCTATGCAAAAGATGCATAGGGGATGTACTTCCATGAAGTGGTGTTCCTGGTCTGCTTGAAAAGGGTGAGTTCAGAGCTGAATGGGTGCCATGCTTAACGTGATGTTTGGCTGTGTGATGCCATGTTTTAAGGGCTTTTGATACATTGTCACTGAAAATGGTTGGTTTCATTCTTGATCCCATCTGTGTTACCAACGCATACAAAGGGAGTGTCACATAACTGCAAAGAAACTGTATCACCACCCCCATTGTGAGTCTAATTATAAT


Protein sequences

Name Description Sequence
Aan.881 translated coding region predicted by ESTScan from UniGene Aan.881

MGVVIQFLCSYVTLPLYALVTQMGSRMKPTIFSDNVSKALKTWHHTAKHHVKHGTHSALNSPFSSRPGTPLHGSTSPMHLLHRHPEDSLDSPSNSPRGSDFEHEGWANEFPSTHPHKYKEHKSLSRDEVNELREIEIQEPSSSSTKLPSGSKPVRTQREDEISDFSFEKS

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
1-84 Mlo
Mlo-related protein

MGVVIQFLCSYVTLPLYALVTQMGSRMKPTIFSDNVSKALKTWHHTAKHHVKHGTHSALNSPFSSRPGTPLHGSTSPMHLLHRH

Seg: seg
140-153 seg

PSSSSTKLPSGSKP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox