PRGDB00064666 (Aan.924)

From PRG Wiki
Jump to: navigation, search
Aan.924
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159687485 (EY104918)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI3979.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI3979 5', mRNA sequence

DNA Sequence

CCCGGGGACCGGCCTCCAATATGTCCCATTGTTCGTAAATAATATCAGCGTTGTCAGTTATCAACATTTTTATAAATTTTGTTTTCACGTTTCCCAAAAAAATTTAAGTCCTAATGACCGAACAAACGTTTAAAGATACAGATAAAGATAAAGATATCGAAGATGACGCACACTCGGAACAATCATCGCCACGTGGCGTATTGGAGATACCGATATCAGGTTCGGATTCCGATAACCAGAGCAGCATAAGCAGCCGTGGTTCGTCTTTTAATGAGAAGTCGTCGTGTGGTGATGAGGAAGAGGTGATAAGTGCGTCGTCGTTACGGTGGAGGAAAGTTTTGAAGTGGAAGACGGTTAAGCCGTGGTTGAAGAAGCTGGGGAAGGGGCAtggtggtggtgatgtggtggttggtgacggtggtgatggtggtgagtgggtggtTGATAAACCGTCGTGGAGGAATTTTAGTTTGGGTGAATTAACGGTTGCTACCGATGGGTTTAACCCTGCTAATTTGGTGGGGCGAGGAGGTCATGCAGAAGTGTACAAAGGATGCTTACCCGATGGCCAAGTTGTGGCGGTGAAGAGAATAACAAAGAAAGAGAAAAAAGACGAGGATAGAGTTGGGGAATTCTTAACAGAGCTTGGGATCATAGCTCATATCAACCATCCAAATGCAGCTCACTTGATCGGCTTCAGCTCATATACTGATTTGCATCTTGTTCTCCAATTCGCACCTCATGGCAGCCTTGCAACATTACTGCATGACCCTGAAGCAAAGTTAGAATGGG


Protein sequences

Name Description Sequence
Aan.924 translated coding region predicted by ESTScan from UniGene Aan.924

MTEQTFKDTDKDKDIEDDAHSEQSSPRGVLEIPISGSDSDNQSSISSRGSSFNEKSSCGDEEEVISASSLRWRKVLKWKTVKPWLKKLGKGHGGGDVVVGDGGDGGEWVVDKPSWRNFSLGELTVATDGFNPANLVGRGGHAEVYKGCLPDGQVVAVKRITKKEKKDEDRVGEFLTELGIIAHINHPNAAHLIGFSSYTDLHLVLQFAPHGSLATLLHDPEAKLEWX

Domains

Domain Start-End Description Sequence

Seg: seg
7-18 seg

KDTDKDKDIEDD

Seg: seg
34-51 seg

ISGSDSDNQSSISSRGSS

Seg: seg
86-112 seg

KKLGKGHGGGDVVVGDGGDGGEWVVDK

superfamily: SSF56112
IPR011009
102-226 Protein kinase-like (PK-like)
Protein kinase-like domain

GGDGGEWVVDKPSWRNFSLGELTVATDGFNPANLVGRGGHAEVYKGCLPDGQVVAVKRITKKEKKDEDRVGEFLTELGIIAHINHPNAAHLIGFSSYTDLHLVLQFAPHGSLATLLHDPEAKLEW

HMMPanther: PTHR24420:SF794
111-226 SUBFAMILY NOT NAMED

DKPSWRNFSLGELTVATDGFNPANLVGRGGHAEVYKGCLPDGQVVAVKRITKKEKKDEDRVGEFLTELGIIAHINHPNAAHLIGFSSYTDLHLVLQFAPHGSLATLLHDPEAKLEW

HMMPanther: PTHR24420
111-226 FAMILY NOT NAMED,FAMILY NOT NAMED

DKPSWRNFSLGELTVATDGFNPANLVGRGGHAEVYKGCLPDGQVVAVKRITKKEKKDEDRVGEFLTELGIIAHINHPNAAHLIGFSSYTDLHLVLQFAPHGSLATLLHDPEAKLEW

Gene3D: G3DSA:3.30.200.20
114-204 no description

SWRNFSLGELTVATDGFNPANLVGRGGHAEVYKGCLPDGQVVAVKRITKKEKKDEDRVGEFLTELGIIAHINHPNAAHLIGFSSYTDLHLV

ProfileScan: PS50011
IPR000719
130-227 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNPANLVGRGGHAEVYKGCLPDGQVVAVKRITKKEKKDEDRVGEFLTELGIIAHINHPNAAHLIGFSSYTDLHLVLQFAPHGSLATLLHDPEAKLEWX

HMMPfam: PF00069
IPR017442
134-218 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NLVGRGGHAEVYKGCLPDGQVVAVKRITKKEKKDEDRVGEFLTELGIIAHINHPNAAHLIGFSSYTDLHLVLQFAPHGSLATLLH

PatternScan: PS00107
IPR017441
136-158 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGRGGHAEVYKGCLPDGQVVAVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox