PRGDB00064667 (Aan.938)

From PRG Wiki
Jump to: navigation, search
Aan.938
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159628869 (EY033748)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAIX403.fwd CAIX Artemisia annua leaf Artemisia annua cDNA clone CAIX403 5', mRNA sequence

DNA Sequence

GTTCACAAGAACTTAAAAAGTAGCAATGTGTTGTTAGATGCAAACATGAGAGCAAAAATAACAAATTTTGGGCTTGCAAGAAGTGTGGATGAAGAAAAGGATGATGGAGGATTTCAGTTGACCAGGCATGTTGTCGGGACATATGGTTACATGCCTCCAGAATACATAGAAAATGGGTTGATTACACCTAAAATGGACGTGTTTGCTTTAGGTGTGTTGATTGCAGAGCTCCTATCAGGTAAAGAAGCCATCACACGATCAACTGAGAGTGGCGTCGATAAAAAGAACGATAAGGAAGTGCAGCTATCGGAGATTATAAAGGAGGTTCTTGCAGGGGATAATGTGAGGGAGAAGTTGACGTCATTTATGGATAGTAGGTTGAGGGGTGAGTATCCTTTGGAATTGGCTTATTCGATGGCGGAGGTTGCTAGTAAATGTGTGGCCACTGATTTAAATGACCGTCCATCTGTGACTGAGGTGTTTATGAAGATGTTGGAGATCTTGTCGTCTTCTTTAGATTGGGATCCGTCTGATGAACTTGAACACTCGAGATCGCTCAGCACTGGCAGATAAAAAAAGATATTTTCCAAGTATTCTATGGTGTATGTGTGTATCGTATGTCAGAACAGTAATGAATCACAAATATGTTGTAATAGACAGTAGAATTTATTGCGTATGTATTGTTGAATGAACTTTTATACAGAAACAGAGCAGAATATCCAATaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Aan.938 translated coding region predicted by ESTScan from UniGene Aan.938

VHKNLKSSNVLLDANMRAKITNFGLARSVDEEKDDGGFQLTRHVVGTYGYMPPEYIENGLITPKMDVFALGVLIAELLSGKEAITRSTESGVDKKNDKEVQLSEIIKEVLAGDNVREKLTSFMDSRLRGEYPLELAYSMAEVASKCVATDLNDRPSVTEVFMKMLEILSSSLDWDPSDELEHSRSLSTGR

Domains

Domain Start-End Description Sequence

HMMPfam: PF00069
IPR017442
1-161 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VHKNLKSSNVLLDANMRAKITNFGLARSVDEEKDDGGFQLTRHVVGTYGYMPPEYIENGLITPKMDVFALGVLIAELLSGKEAITRSTESGVDKKNDKEVQLSEIIKEVLAGDNVREKLTSFMDSRLRGEYPLELAYSMAEVASKCVATDLNDRPSVTEVF

ProfileScan: PS50011
IPR000719
1-168 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

VHKNLKSSNVLLDANMRAKITNFGLARSVDEEKDDGGFQLTRHVVGTYGYMPPEYIENGLITPKMDVFALGVLIAELLSGKEAITRSTESGVDKKNDKEVQLSEIIKEVLAGDNVREKLTSFMDSRLRGEYPLELAYSMAEVASKCVATDLNDRPSVTEVFMKMLEIL

superfamily: SSF56112
IPR011009
1-160 Protein kinase-like (PK-like)
Protein kinase-like domain

VHKNLKSSNVLLDANMRAKITNFGLARSVDEEKDDGGFQLTRHVVGTYGYMPPEYIENGLITPKMDVFALGVLIAELLSGKEAITRSTESGVDKKNDKEVQLSEIIKEVLAGDNVREKLTSFMDSRLRGEYPLELAYSMAEVASKCVATDLNDRPSVTEV

Gene3D: G3DSA:1.10.510.10
1-162 no description

VHKNLKSSNVLLDANMRAKITNFGLARSVDEEKDDGGFQLTRHVVGTYGYMPPEYIENGLITPKMDVFALGVLIAELLSGKEAITRSTESGVDKKNDKEVQLSEIIKEVLAGDNVREKLTSFMDSRLRGEYPLELAYSMAEVASKCVATDLNDRPSVTEVFM

HMMPanther: PTHR24420:SF481
1-179 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VHKNLKSSNVLLDANMRAKITNFGLARSVDEEKDDGGFQLTRHVVGTYGYMPPEYIENGLITPKMDVFALGVLIAELLSGKEAITRSTESGVDKKNDKEVQLSEIIKEVLAGDNVREKLTSFMDSRLRGEYPLELAYSMAEVASKCVATDLNDRPSVTEVFMKMLEILSSSLDWDPSDE

HMMPanther: PTHR24420
1-179 FAMILY NOT NAMED,FAMILY NOT NAMED

VHKNLKSSNVLLDANMRAKITNFGLARSVDEEKDDGGFQLTRHVVGTYGYMPPEYIENGLITPKMDVFALGVLIAELLSGKEAITRSTESGVDKKNDKEVQLSEIIKEVLAGDNVREKLTSFMDSRLRGEYPLELAYSMAEVASKCVATDLNDRPSVTEVFMKMLEILSSSLDWDPSDE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox