PRGDB00064669 (Aan.1192)

From PRG Wiki
Jump to: navigation, search
Aan.1192
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159724534 (EY072969)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Artemisia annua

Comment?

CAZI10480.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI10480 5', mRNA sequence

DNA Sequence

CCAGTTTTTAAGTTTATATTATCTATCTTTTTTAGTTCCATAATTATAATCCCAACATTCTCTTGTCCCGTTTATCAAAAGCAAGCACTACTCCACTTCAAATCCACCCTCACCGCCATCCACAATTCCAAATATTCCGTTAAGTTTGTAGAACTAGACTCATGGAATTCTTCGAGTTCTGATTGTTGCTCTTGGGAGCGTGTTACTTGCTCCAGAACCGGAAGTGTTACTGAGCTTCAGCTATCTGGGGTAGCCATTCCTCCTATAGATTCTGATCCAGTTTCGATATCTTCTGAAATCTTGAGTCCGATTTTTCGTATTCGGTCACTTGAACTTCTTGATATCTCGCGGAATCTTTTGGAAGGCGAGATCCCAGGAGAGGGGTTTGGCAATCTCACCAAACTGCTTCATCTTGACATGATGTATAATAGTTTCAATGGTCCCATCCCCAACCAACTTTTCCAGTTAACAAAGTTGAAGGATATTTCATTACGAAATAATCATTTCTCCGGTGGAATCCCATTATCAATTGTAAACCTCACGAAATTAGAATCACTGGATTTGTCTCAAAATTATTTATCATTGGAAATTCCAACCTCCATAGGAAGACTAACCAACTTGACATTTCTGAACTTGATGCTTAACCAGTTTACAGGCCCGATACCATCATCGATGCAAAACTTGAGCAAGCTAAGTGCCCTTCTACTCGGCGGCAACATGTTCACCGGAGAGATCCC


Protein sequences

Name Description Sequence
Aan.1192 translated coding region predicted by ESTScan from UniGene Aan.1192

PVFKFILSIFFSSIIIIPTFSCPVYQKQALLHFKSTLTAIHNSKYSVKFVELDSWNSSSSDCCSWERVTCSRTGSVTELQLSGVAIPPIDSDPVSISSEILSPIFRIRSLELLDISRNLLEGEIPGEGFGNLTKLLHLDMMYNSFNGPIPNQLFQLTKLKDISLRNNHFSGGIPLSIVNLTKLESLDLSQNYLSLEIPTSIGRLTNLTFLNLMLNQFTGPIPSSMQNLSKLSALLLGGNMFTGEIP


Domains

Domain Start-End Description Sequence

Seg: seg
5-21 seg

FILSIFFSSIIIIPTFS

HMMPanther: PTHR24420
5-246 FAMILY NOT NAMED,FAMILY NOT NAMED

FILSIFFSSIIIIPTFSCPVYQKQALLHFKSTLTAIHNSKYSVKFVELDSWNSSSSDCCSWERVTCSRTGSVTELQLSGVAIPPIDSDPVSISSEILSPIFRIRSLELLDISRNLLEGEIPGEGFGNLTKLLHLDMMYNSFNGPIPNQLFQLTKLKDISLRNNHFSGGIPLSIVNLTKLESLDLSQNYLSLEIPTSIGRLTNLTFLNLMLNQFTGPIPSSMQNLSKLSALLLGGNMFTGEIP

superfamily: SSF52058
20-246 L domain-like,LRR

FSCPVYQKQALLHFKSTLTAIHNSKYSVKFVELDSWNSSSSDCCSWERVTCSRTGSVTELQLSGVAIPPIDSDPVSISSEILSPIFRIRSLELLDISRNLLEGEIPGEGFGNLTKLLHLDMMYNSFNGPIPNQLFQLTKLKDISLRNNHFSGGIPLSIVNLTKLESLDLSQNYLSLEIPTSIGRLTNLTFLNLMLNQFTGPIPSSMQNLSKLSALLLGGNMFTGEIP

HMMPfam: PF08263
IPR013210
25-71 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

YQKQALLHFKSTLTAIHNSKYSVKFVELDSWNSSSSDCCSWERVTCS

Gene3D: G3DSA:3.80.10.10
28-246 no description

QALLHFKSTLTAIHNSKYSVKFVELDSWNSSSSDCCSWERVTCSRTGSVTELQLSGVAIPPIDSDPVSISSEILSPIFRIRSLELLDISRNLLEGEIPGEGFGNLTKLLHLDMMYNSFNGPIPNQLFQLTKLKDISLRNNHFSGGIPLSIVNLTKLESLDLSQNYLSLEIPTSIGRLTNLTFLNLMLNQFTGPIPSSMQNLSKLSALLLGGNMFTGEIP

Seg: seg
53-65 seg

DSWNSSSSDCCSW

Seg: seg
86-100 seg

IPPIDSDPVSISSEI

HMMPfam: PF00560
IPR001611
109-132 LRR_1
Leucine-rich repeat

SLELLDISRNLLEGEIPGEGFGNL

FPrintScan: PR00019
110-123 LEURICHRPT,Leucine-rich repeat signature

LELLDISRNLLEGE

FPrintScan: PR00019
180-193 LEURICHRPT,Leucine-rich repeat signature

LTKLESLDLSQNYL

HMMPfam: PF12799
181-218 LRR_4,Leucine Rich repeats (2 copies)

TKLESLDLSQNYLSLEIPTSIGRLTNLTFLNLMLNQFT

Seg: seg
204-218 seg

LTNLTFLNLMLNQFT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox