PRGDB00064670 (Aan.1238)

From PRG Wiki
Jump to: navigation, search
Aan.1238
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259857034 (EZ217310)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig14321.Aylt mRNA sequence

DNA Sequence

CACCATTAATTTTAATAATGTATGATAATCTTTTCTACAGAACATCCAACTGTAAACAAAACTAGAAAATTTTATAAGAAAAAAGTCCTTGTAATTTACTGGAAACGGATTTTGACACTTTCGACATAAAGAAACAAGTTCCGCTCCTTTAAAACAGATCTTTGTCGCATAATTGGTTCCTTCCCATAGAATTTTTTATTTGGTTCGGTTGGTTGATTTGGGACTACCAATGAAAATACAAATCACGGAGACAAAGTGGCATTCTCTTCACATATGTTACATACACATCATAGAAATACGGAATGGTTATAACCTCCAAGTCTATAACTACCATCGTTTTACTAATAATCTCTAATGAGACATGCCATTCAAGATATAAAGCCTTTGCTTTTCAAACTCTCAACACTGTCCTTAATGATCTGCTCCATAGGAATGAACTCTAGACCCAAGTCCATGAGCTTTTTGGATGCAGTCTTGTATCTCAACAATCCTGGTTGGGTATCTTTCGGCAACCTGGGGATGTTATACTCGGGGTACAGTTCTGCAACCTTGGCTGCAAAATCACCATAATGGGTAATGGCTTCAACACAGAGGTGTCTTCCGGTTGCTGATGTGTTTTCATACACCAATATATGAGCTAAGGCCACGTCTTTAACATGAACAGAACCCATGAAGTAATTTTCATATGTATCCGTACATCCTTGAATAAGACGAAGAATCATTAGCATGCTCGCATTAAGTGTTGGAGGAATTATTGGACCCATCACTGTTCCAGGGTTCACCACAACTATATCTAAGCCTTTCTCTTTAGCGAAATCCCATGCTGCTTTCTCAGCTAGTGTTTTGGAGAGTGGATACCACACCTCATTTTGCTTGCAATACTCAGCATCGGTCCAGCAATCCTCACTCTTGGGGACATCAGCAGGCCATGAAGGACTAGGTACAATGGCTGATACAGATGAAGTGACAACCACACGCTTCACTCCAAGCTCCTTTGCCGCTGTGAGTACATTGTTCGTCCCCCTAACAGCAGGTTCCAGTAACTCCTTCTCAGGATCATAGACTTTATCAACAATACAAGGCGAAGCCAAATGAAACACACCAGACACACCACTAACCGCCTTCACAATGGAGTCATAGTCAAGCAAGTCAATCTCAAACAAATGTAGCCTCGTTTCCGCACCTTCTAAACTTTCTAAATGCTTAGTTTCCTTCTCATCCTTGAGATTTTTGACAGTGGCATTAACGGTGTAACCGCGACTGAGAAGGAGTTTGATGAGGTGTGATCCGATGTAACCGCTTCCGCCTGTTACGCAAACCAACTTTGCTGTTTGTTCTGTCATTGTTTTTTTCTCTTATCTTTGATGTTTCGGAGGTTATTTAGTTCAGTGCTTTGTGAGTTTGTGACTGTGTTTC


Protein sequences

Name Description Sequence
Aan.1238 translated coding region predicted by ESTScan from UniGene Aan.1238

MTEQTAKLVCVTGGSGYIGSHLIKLLLSRGYTVNATVKNLKDEKETKHLESLEGAETRLHLFEIDLLDYDSIVKAVSGVSGVFHLASPCIVDKVYDPEKELLEPAVRGTNNVLTAAKELGVKRVVVTSSVSAIVPSPSWPADVPKSEDCWTDAEYCKQNEVWYPLSKTLAEKAAWDFAKEKGLDIVVVNPGTVMGPIIPPTLNASMLMILRLIQGCTDTYENYFMGSVHVKDVALAHILVYENTSATGRHLCVEAITHYGDFAAKVAELYPEYNIPRLPKDTQPGLLRYKTASKKLMDLGLEFIPMEQIIKDSVESLKSKGFIS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
1-323 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

MTEQTAKLVCVTGGSGYIGSHLIKLLLSRGYTVNATVKNLKDEKETKHLESLEGAETRLHLFEIDLLDYDSIVKAVSGVSGVFHLASPCIVDKVYDPEKELLEPAVRGTNNVLTAAKELGVKRVVVTSSVSAIVPSPSWPADVPKSEDCWTDAEYCKQNEVWYPLSKTLAEKAAWDFAKEKGLDIVVVNPGTVMGPIIPPTLNASMLMILRLIQGCTDTYENYFMGSVHVKDVALAHILVYENTSATGRHLCVEAITHYGDFAAKVAELYPEYNIPRLPKDTQPGLLRYKTASKKLMDLGLEFIPMEQIIKDSVESLKSKGFI

HMMPanther: PTHR10366
1-323 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MTEQTAKLVCVTGGSGYIGSHLIKLLLSRGYTVNATVKNLKDEKETKHLESLEGAETRLHLFEIDLLDYDSIVKAVSGVSGVFHLASPCIVDKVYDPEKELLEPAVRGTNNVLTAAKELGVKRVVVTSSVSAIVPSPSWPADVPKSEDCWTDAEYCKQNEVWYPLSKTLAEKAAWDFAKEKGLDIVVVNPGTVMGPIIPPTLNASMLMILRLIQGCTDTYENYFMGSVHVKDVALAHILVYENTSATGRHLCVEAITHYGDFAAKVAELYPEYNIPRLPKDTQPGLLRYKTASKKLMDLGLEFIPMEQIIKDSVESLKSKGFI

superfamily: SSF51735
7-319 NAD(P)-binding Rossmann-fold domains

KLVCVTGGSGYIGSHLIKLLLSRGYTVNATVKNLKDEKETKHLESLEGAETRLHLFEIDLLDYDSIVKAVSGVSGVFHLASPCIVDKVYDPEKELLEPAVRGTNNVLTAAKELGVKRVVVTSSVSAIVPSPSWPADVPKSEDCWTDAEYCKQNEVWYPLSKTLAEKAAWDFAKEKGLDIVVVNPGTVMGPIIPPTLNASMLMILRLIQGCTDTYENYFMGSVHVKDVALAHILVYENTSATGRHLCVEAITHYGDFAAKVAELYPEYNIPRLPKDTQPGLLRYKTASKKLMDLGLEFIPMEQIIKDSVESLKS

Gene3D: G3DSA:3.40.50.720
IPR016040
7-226 no description
NAD(P)-binding domain

KLVCVTGGSGYIGSHLIKLLLSRGYTVNATVKNLKDEKETKHLESLEGAETRLHLFEIDLLDYDSIVKAVSGVSGVFHLASPCIVDKVYDPEKELLEPAVRGTNNVLTAAKELGVKRVVVTSSVSAIVPSPSWPADVPKSEDCWTDAEYCKQNEVWYPLSKTLAEKAAWDFAKEKGLDIVVVNPGTVMGPIIPPTLNASMLMILRLIQGCTDTYENYFMG

HMMPfam: PF01370
IPR001509
9-250 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGSGYIGSHLIKLLLSRGYTVNATVKNLKDEKETKHLESLEGAETRLHLFEIDLLDYDSIVKAVSGVSGVFHLASPCIVDKVYDPEKELLEPAVRGTNNVLTAAKELGVKRVVVTSSVSAIVPSPSWPADVPKSEDCWTDAEYCKQNEVWYPLSKTLAEKAAWDFAKEKGLDIVVVNPGTVMGPIIPPTLNASMLMILRLIQGCTDTYENYFMGSVHVKDVALAHILVYENTSATGRH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox