PRGDB00064671 (Aan.1282)

From PRG Wiki
Jump to: navigation, search
Aan.1282
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259557045 (EZ170323)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig29729, mRNA sequence

DNA Sequence

CAACCAGAAGAGGGGGAAGCCTTGAGCTTTCTCATTCAGATATTCATAAAAAAGTCAAATTTATGAAATTGAAAGTCAAAGAACACAAATAACATACAAACATGCTTGATACATATGATACGTCACCAAGAATGTAAACGTACTCTTATGTCTCGTACACTTATGCAACATGAAAATTAAACCACAATTACGAACATCTTTAACAACTTAACATTTATTTAACTACGACATGCACTCCTCCTTGTAGCAGTTACCCACAACTTCACCATACAAGCTTGATGATAGACCTTATATATTTTGAAGCACATCAAGAATATGCTGCAACTCATTGACAACAATTTCAATTTTCATTCGTTGTGGTGGTGAATCCACAGAGCACGATACTCCAATCTTGATAGTTGCAACCAAACATTCTTCCACTTTCTTTGCATTTGCTTCAGTACTTTGCAACACAATTGCATCATCATCAATAACATCTACTACATGATCTGGTAATGCCATGTAAGCAAATTTATGAAGGCTAAGACCTTCCTTAAACATGTCATGTGTCGGCCTTTTCCCAGTCATCACCTCTAGTAATAATATTCCAAAACTGTAGACGTCCCCACAACTTGTCATCTCGCTCCCAATACCATACTCTGGAGGTGCATAACCAATTGTTCCTTTAACCCCGGTTGAGCTGTTTTGGTTTAAGTCTGTACCAATTAGTCGGGCTAAACCAAAGTCTCCAACATGAGCCACCATATGTTC


Protein sequences

Name Description Sequence
Aan.1282 translated coding region predicted by ESTScan from UniGene Aan.1282

EHMVAHVGDFGLARLIGTDLNQNSSTGVKGTIGYAPPEYGIGSEMTSCGDVYSFGILLLEVMTGKRPTHDMFKEGLSLHKFAYMALPDHVVDVIDDDAIVLQSTEANAKKVEECLVATIKIGVSCSVDSPPQRMKIEIVVNELQHILDVLQNI

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-143 Protein kinase-like (PK-like)
Protein kinase-like domain

EHMVAHVGDFGLARLIGTDLNQNSSTGVKGTIGYAPPEYGIGSEMTSCGDVYSFGILLLEVMTGKRPTHDMFKEGLSLHKFAYMALPDHVVDVIDDDAIVLQSTEANAKKVEECLVATIKIGVSCSVDSPPQRMKIEIVVNEL

ProfileScan: PS50011
IPR000719
1-153 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EHMVAHVGDFGLARLIGTDLNQNSSTGVKGTIGYAPPEYGIGSEMTSCGDVYSFGILLLEVMTGKRPTHDMFKEGLSLHKFAYMALPDHVVDVIDDDAIVLQSTEANAKKVEECLVATIKIGVSCSVDSPPQRMKIEIVVNELQHILDVLQNI

Gene3D: G3DSA:1.10.510.10
3-144 no description

MVAHVGDFGLARLIGTDLNQNSSTGVKGTIGYAPPEYGIGSEMTSCGDVYSFGILLLEVMTGKRPTHDMFKEGLSLHKFAYMALPDHVVDVIDDDAIVLQSTEANAKKVEECLVATIKIGVSCSVDSPPQRMKIEIVVNELQ

HMMPfam: PF07714
IPR001245
3-75 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

MVAHVGDFGLARLIGTDLNQNSSTGVKGTIGYAPPEYGIGSEMTSCGDVYSFGILLLEVMTGKRPTHDMFKEG

HMMPanther: PTHR24420:SF474
3-146 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MVAHVGDFGLARLIGTDLNQNSSTGVKGTIGYAPPEYGIGSEMTSCGDVYSFGILLLEVMTGKRPTHDMFKEGLSLHKFAYMALPDHVVDVIDDDAIVLQSTEANAKKVEECLVATIKIGVSCSVDSPPQRMKIEIVVNELQHI

HMMPanther: PTHR24420
3-146 FAMILY NOT NAMED,FAMILY NOT NAMED

MVAHVGDFGLARLIGTDLNQNSSTGVKGTIGYAPPEYGIGSEMTSCGDVYSFGILLLEVMTGKRPTHDMFKEGLSLHKFAYMALPDHVVDVIDDDAIVLQSTEANAKKVEECLVATIKIGVSCSVDSPPQRMKIEIVVNELQHI

Seg: seg
90-100 seg

VVDVIDDDAIV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox