PRGDB00064672 (Aan.1302)

From PRG Wiki
Jump to: navigation, search
Aan.1302
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159595130 (EY091403)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI19865.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI19865 5', mRNA sequence

DNA Sequence

CAAGTATGAAAAAGGCAAGCTCATAGGCAAAGGAACATTTGCAAAAGTGTATCATGGTCGAGAACTCGCTACGGGCGAAAGCGTAGCGATAAAAGTCATTAGCAAGGAACAAGTGAAGGATCAAGGCATGGTGGAACAAATCCAGCGAGAAATATCCGCAACTCGACTAGTTAGACATCCTAATATAGTCGAGTTGCGCGAAGTTCTCGCCACCAGATCCAAAATCTATTATGTAATGGAATATGTATCTGGTGGCGAGTTGTTCGATAAAGTAAAAGGGAATAAAAAGTTAAAAGAAGACGTGGCACGCAAGTATTTTCAACAGCTGATTTCAGCTGTTGATTTTTGTCATAGCCGCGGTGTGTCACACCGCGACATTAAGCCTGAGAATTTATTGCTTGATGGTAATGATGATTTGAAAATTACGGATTTTGGGTTTTCTGCTCTACCTGAGCAGAAAAGGCTAGATGGCTTGTTGCACACGCAGTGTGGTACCCCTGCTTACGTGGCACCAGAAGTGCTACGTAAGAAAGGGTACGACGGTGCTAAAGCTGATATTTGGTCATGTGGGGTTGTTTTGTATGTTTTGTTAGCTGGTTTTTTGCCTTTTCATGATGTGAATTTGATGAATTTGTATCGAAAAATATTTAAAGCGGAATATGAGTTTCCGCCGTGGTTTTCTCACGATACGCGGAAACTCATTTCCAAGATTTTGATGGCGGATCCTGAGCGCAGGATCTCCATCGAAGGAATAAAGCGCGTTCCGTGGTATAGGAAAGGAATGTCACGACCG


Protein sequences

Name Description Sequence
Aan.1302 translated coding region predicted by ESTScan from UniGene Aan.1302

XKYEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQLISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPWYRKGMSRP

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
2-110 no description

KYEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQL

superfamily: SSF56112
IPR011009
2-260 Protein kinase-like (PK-like)
Protein kinase-like domain

KYEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQLISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPWYRK

HMMPanther: PTHR24343
2-264 FAMILY NOT NAMED,SERINE/THREONINE KINASE

KYEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQLISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPWYRKGMSR

HMMPanther: PTHR24343:SF45
2-264 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

KYEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQLISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPWYRKGMSR

ProfileScan: PS50011
IPR000719
3-258 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQLISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPWY

HMMPfam: PF00069
IPR017442
3-257 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQLISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPW

HMMSmart: SM00219
IPR020635
3-262 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQLISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPWYRKGM

HMMSmart: SM00220
IPR002290
3-258 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEKGKLIGKGTFAKVYHGRELATGESVAIKVISKEQVKDQGMVEQIQREISATRLVRHPNIVELREVLATRSKIYYVMEYVSGGELFDKVKGNKKLKEDVARKYFQQLISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPWY

PatternScan: PS00107
IPR017441
9-32 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGTFAKVYHGRELATGESVAIK

Gene3D: G3DSA:1.10.510.10
111-260 no description

ISAVDFCHSRGVSHRDIKPENLLLDGNDDLKITDFGFSALPEQKRLDGLLHTQCGTPAYVAPEVLRKKGYDGAKADIWSCGVVLYVLLAGFLPFHDVNLMNLYRKIFKAEYEFPPWFSHDTRKLISKILMADPERRISIEGIKRVPWYRK

PatternScan: PS00108
IPR008271
122-134 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VSHRDIKPENLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox