PRGDB00064673 (Aan.1444)

From PRG Wiki
Jump to: navigation, search
Aan.1444
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259541756 (EZ155621)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig15027, mRNA sequence

DNA Sequence

CGGCCCATTTTCGGTACTATGTTTTGGGATATCGGCGGTAAAAGAAACACCCAACAAAATCTGACAAACTCCATTGGTTCTATGTATGGTGCGGTTCTTTTCTTGGGAATCCAAAACGCATCAGCAGTGCAACCAGTTGTTGACATTGAACGGACTGTCTTTTATAGAGAAAGAGCCGCTGGAATGTACTCAGCTTTACCATATGCTTTTGCTCAGGTGTTGGTTGAGATCCCATATGTATTCGCACAAGCAGTAGTATACAGTTTAATAGTGTACGCCATGATCGGGTTCGAGTGGACTGCTGCTAAATTTTTTTGGTATCTCTTTTTCCAATTCTGTTGCTTCCTCTACATGACATATTATGGTATGATGACTGTCGCCATCACCCCCAACGCAAGCATCGCTGCCATCATTGCTGCCTCATTTTACAAAATATTCAATCTCTTCTCCGGATACATCATTCCACGACCCAGTATTCCTGTCTGGTGGAGATGGTACTACTGGGGTAATCCGTTGGCATGGACTATTTACGGGATGATTGTTTCACAGTTTGGGGACTACACGAATGAGTTTCCTAACGGTCAAACCGTCAAAGAATATCTAGATGATTATCTTGGTATGAAGCGTAGTTTTATTGGTCCTGTTGCTGGGGTGCATATTGGATTGGTATTGTTCTTTGCGTTCATCTTTGCTTACTGCATCCGATCCTTCAATTTCCAGAAGAGATAATTTTATTATTTGGTTTCATAGATGTAAAATATTACATAAATGTTTAACGACTTGTATTATATTTGTTTTTTGTATCTGATATTCAATATAACAGACTCAAACTAGGGTCTCTTCGGTAGCCT


Protein sequences

Name Description Sequence
Aan.1444 translated coding region predicted by ESTScan from UniGene Aan.1444

RPIFGTMFWDIGGKRNTQQNLTNSIGSMYGAVLFLGIQNASAVQPVVDIERTVFYRERAAGMYSALPYAFAQVLVEIPYVFAQAVVYSLIVYAMIGFEWTAAKFFWYLFFQFCCFLYMTYYGMMTVAITPNASIAAIIAASFYKIFNLFSGYIIPRPSIPVWWRWYYWGNPLAWTIYGMIVSQFGDYTNEFPNGQTVKEYLDDYLGMKRSFIGPVAGVHIGLVLFFAFIFAYCIRSFNFQKR


Domains

Domain Start-End Description Sequence

HMMPfam: PF01061
IPR013525
3-184 ABC2_membrane
ABC-2 type transporter

IFGTMFWDIGGKRNTQQNLTNSIGSMYGAVLFLGIQNASAVQPVVDIERTVFYRERAAGMYSALPYAFAQVLVEIPYVFAQAVVYSLIVYAMIGFEWTAAKFFWYLFFQFCCFLYMTYYGMMTVAITPNASIAAIIAASFYKIFNLFSGYIIPRPSIPVWWRWYYWGNPLAWTIYGMIVSQF

HMMPanther: PTHR19241:SF10
3-242 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

IFGTMFWDIGGKRNTQQNLTNSIGSMYGAVLFLGIQNASAVQPVVDIERTVFYRERAAGMYSALPYAFAQVLVEIPYVFAQAVVYSLIVYAMIGFEWTAAKFFWYLFFQFCCFLYMTYYGMMTVAITPNASIAAIIAASFYKIFNLFSGYIIPRPSIPVWWRWYYWGNPLAWTIYGMIVSQFGDYTNEFPNGQTVKEYLDDYLGMKRSFIGPVAGVHIGLVLFFAFIFAYCIRSFNFQKR

HMMPanther: PTHR19241
3-242 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

IFGTMFWDIGGKRNTQQNLTNSIGSMYGAVLFLGIQNASAVQPVVDIERTVFYRERAAGMYSALPYAFAQVLVEIPYVFAQAVVYSLIVYAMIGFEWTAAKFFWYLFFQFCCFLYMTYYGMMTVAITPNASIAAIIAASFYKIFNLFSGYIIPRPSIPVWWRWYYWGNPLAWTIYGMIVSQFGDYTNEFPNGQTVKEYLDDYLGMKRSFIGPVAGVHIGLVLFFAFIFAYCIRSFNFQKR

Seg: seg
104-117 seg

FFWYLFFQFCCFLY

Seg: seg
132-141 seg

ASIAAIIAAS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox