PRGDB00064675 (Aan.1752)

From PRG Wiki
Jump to: navigation, search
Aan.1752
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159693012 (EY112143)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI7693.rev CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI7693 3', mRNA sequence

DNA Sequence

ACAGAATCAAATTTCAATCTTCTGGATTACAAGCAATGATATCTACAATACAGGCTCTGAACATTTCATTCGAAGCAGAATGTAATAGTTTTAGAAGCTCTTGTGTGATAGATTATACAGTTATTTGACAAATATCAGGCATATCACAACAGCCAGCAAAAATATACAGTACATAATAACTACAAACAAACAAGCTTCAGTAGAATAATATAAGATAGCTCAAAGTTTCCGTGACCATGTTTGAACCATATGGCCAAAGCTTCTCCCCACTTCTTCAGCACCACAGCTCAAACAATCTAGTCCGTATCATTTGTGTCAAAAAGAAGTGGAAATTCATCATAGTGTTGTGAGCCGCCTAGTTCTTGTGCTACGCTACTCAATGCTTCAAAAACCCGGTACATTGACCATCTTGCCCGGGGTTGAGAAGCCACACAGTTACCTGCAATACGAAGAACTTGAACAATTTCATCATCATGACCTGTGCCAGAAATATTCTTATCAATGACATTCTCAATTTGTCCAGAGCTAGACATTTTGTTTACCCAGTCCACTAAATTACCCTTAAACCCTTCTTCAGCAGCAGTTACACTGAGAGGTTTTTGCCCAGTTGCCAATTCCATGAGCACTACGCCAAAACCATAAGTATCACCTTTTGTAGAAGCAACCAAGGTGCTCGAGTACTCAGGGGCCACATAACCAAACTCACCCACACCCCCATTAGCATAGCTACTCTCGTTCGGATGGTCATAAGGGGAAGTCAAAAGTCTAGCCAATCCAAATCCACTAATCTCGCATTGTAATCGTCATCAAGAAATATGGCA


Protein sequences

Name Description Sequence
Aan.1752 translated coding region predicted by ESTScan from UniGene Aan.1752

CHISXXRLQCEISGFGLARLLTSPYDHPNESSYANGGVGEFGYVAPEYSSTLVASTKGDTYGFGVVLMELATGQKPLSVTAAEEGFKGNLVDWVNKMSSSGQIENVIDKNISGTGHDDEIVQVLRIAGNCVASQPRARWSMYRVFEALSSVAQELGGSQHYDEFPLLFDTNDTD

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-151 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

CHISXXRLQCEISGFGLARLLTSPYDHPNESSYANGGVGEFGYVAPEYSSTLVASTKGDTYGFGVVLMELATGQKPLSVTAAEEGFKGNLVDWVNKMSSSGQIENVIDKNISGTGHDDEIVQVLRIAGNCVASQPRARWSMYRVFEALSSV

superfamily: SSF56112
IPR011009
7-148 Protein kinase-like (PK-like)
Protein kinase-like domain

RLQCEISGFGLARLLTSPYDHPNESSYANGGVGEFGYVAPEYSSTLVASTKGDTYGFGVVLMELATGQKPLSVTAAEEGFKGNLVDWVNKMSSSGQIENVIDKNISGTGHDDEIVQVLRIAGNCVASQPRARWSMYRVFEAL

HMMPfam: PF00069
IPR017442
8-144 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LQCEISGFGLARLLTSPYDHPNESSYANGGVGEFGYVAPEYSSTLVASTKGDTYGFGVVLMELATGQKPLSVTAAEEGFKGNLVDWVNKMSSSGQIENVIDKNISGTGHDDEIVQVLRIAGNCVASQPRARWSMYRV

Gene3D: G3DSA:1.10.510.10
8-147 no description

LQCEISGFGLARLLTSPYDHPNESSYANGGVGEFGYVAPEYSSTLVASTKGDTYGFGVVLMELATGQKPLSVTAAEEGFKGNLVDWVNKMSSSGQIENVIDKNISGTGHDDEIVQVLRIAGNCVASQPRARWSMYRVFEA

HMMPanther: PTHR24420:SF477
16-165 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GLARLLTSPYDHPNESSYANGGVGEFGYVAPEYSSTLVASTKGDTYGFGVVLMELATGQKPLSVTAAEEGFKGNLVDWVNKMSSSGQIENVIDKNISGTGHDDEIVQVLRIAGNCVASQPRARWSMYRVFEALSSVAQELGGSQHYDEFP

HMMPanther: PTHR24420
16-165 FAMILY NOT NAMED,FAMILY NOT NAMED

GLARLLTSPYDHPNESSYANGGVGEFGYVAPEYSSTLVASTKGDTYGFGVVLMELATGQKPLSVTAAEEGFKGNLVDWVNKMSSSGQIENVIDKNISGTGHDDEIVQVLRIAGNCVASQPRARWSMYRVFEALSSVAQELGGSQHYDEFP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox