PRGDB00064677 (Aan.2138)

From PRG Wiki
Jump to: navigation, search
Aan.2138
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259872181 (EZ232457)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig29468.Aylt mRNA sequence

DNA Sequence

GGCCGGGGGCAACTTTCTAACACACACACACACACACACACTCTATAAAAACATTGAGCTTTAAAGGAGGTTACCTTTCATTTGGGTAACATATCATTTTCTTTAAATCAAAGAAAAATAAAAAATGGGCGTTGTTTCAATTCTTCACACGGTCTTTGGTGTTTTCGGAGATGCTACTGGTTTGTTTCTCTTCTTGGCACCAACGATAACGTTTAAGAGAGTATTGAAGAACAAATCAACTGAACAATTCTCAGGGATTCCTTACCCTATGACCTTACTCAACTGTCTACTTTCTGCCTGGTACGGACTACCATTCATATCAGAAAACAATACACTAGTGACGGTTATCAATGGTACCGGTGCGGGAATAGAAGCAATTTACGTGTTGATATTTCTAATATATGCAACCTAAAAAGGAGAAAGCAAAGGTGTTTGGGTTGGTCACGTTTGTTCTTGCTGCCTTCTCCACTGTTGCCTTAGTTTCCGTCTTTGCTCTTCATGGAAAAACCCGTCGCTACTTCTGCGGTTTCGCTGCAGCCATTTTCTCCGTCATCATGTACGGCTCGCCCCTCTCTATCATGAGGACAGTGATCAGGACCAAGAGTGTGGAATTTATGCCATTTTTCCTGTCGCTATTTGTTTTCTTGTGTGGTACTTCCTGGTTTCTATTTGGCCTCCTTGGAAATGATCCTTTTGTTTATGTATGCAACGGGTTCGGAAGCTTATTGGGGGCACTACAACTGATTCTGTATGCCATATACAGAAAGAACAAGGGACAGAAAGATGAGAAAACTGCCGCGATTGAGATCGGGTCGGCCAATGGTAACAAACACGTGGAGAAAGGAAAACCCACACCAGAGAACATCAATCAAGTGTAGTGATCATTTGTTATGTTCTAATCCTACGAGTTTAAGCATTTTTCCCCTTTATGATGAAATTTGTCTAGCTTTTGTTTACTTGTCTAAATCGCCACATGTAGGGGACTAGTGACACC


Protein sequences

Name Description Sequence
Aan.2138 translated coding region predicted by ESTScan from UniGene Aan.2138

MGVVSILHTVFGVFGDATGLFLFLAPTITFKRVLKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFISENNTLVTVINGTGAGIEAIYVLIFLIYATKKEKAKVFGLVTFVLAAFSTVALVSVFALHGKTRRYFCGFAAAIFSVIMYGSPLSIMRTVIRTKSVEFMPFFLSLFVFLCGTSWFLFGLLGNDPFVYVCNGFGSLLGALQLILYAIYRKNKGQKDEKTAAIEIGSANGNKHVEKGKPTPENINQV


Domains

Domain Start-End Description Sequence

HMMPfam: PF03083
IPR004316
10-97 MtN3_slv
RAG1-activating protein-1-related

VFGVFGDATGLFLFLAPTITFKRVLKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFISENNTLVTVINGTGAGIEAIYVLIFLIYATKK

HMMPanther: PTHR10791
IPR004316
20-227 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

LFLFLAPTITFKRVLKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFISENNTLVTVINGTGAGIEAIYVLIFLIYATKKEKAKVFGLVTFVLAAFSTVALVSVFALHGKTRRYFCGFAAAIFSVIMYGSPLSIMRTVIRTKSVEFMPFFLSLFVFLCGTSWFLFGLLGNDPFVYVCNGFGSLLGALQLILYAIYRKNKGQKDEKTAAIE

HMMPfam: PF03083
IPR004316
133-216 MtN3_slv
RAG1-activating protein-1-related

CGFAAAIFSVIMYGSPLSIMRTVIRTKSVEFMPFFLSLFVFLCGTSWFLFGLLGNDPFVYVCNGFGSLLGALQLILYAIYRKNK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox