PRGDB00064721 (Aan.10340)

From PRG Wiki
Jump to: navigation, search
Aan.10340
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159605544 (EY115285)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI9295.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI9295 5', mRNA sequence

DNA Sequence

CAGGGTTCTTAACTAAAGAGTCGGATGTTTATTCTTttggtgttgtgttgtgtgatgtattgtgtggcaggttgtgtATGGTCGACGATAAGTTTCAGCCATTAGTAGGATTAACTCGACAATCCTTTAGACAAAATACGGTTAATCAAATTGTTTTAACGAATATAAGGGATGAAATAAATCCGAATTCTTTGGATGTGTTTTCGAAAGTTGCATATCAATGCTTGAAGCTAGAACGTGATGAACGTCCATTAATTACGGAGATTGTAAGGGAGCTTGAAGCAGCACTTCAATGTCAAGTATCTGAACCATCTACCTCCTTCTCATTCTCCTCACCCTCCCCCTCGGATTCCTCATCCTACTCCTCCATAAAAAGGTCGCAACCATGCCGTCGTTTCCAATTTCATGAGATTCAGTTAGCAACAAAAAACTTTGACGAAACATTATTAGTTGGGAGAGGAGCTTTTAGGAAAGTCTACAAAGGTAAGATTTTTGATGGATCAAGTCTTGTAATGGCTGCAATTAAACGGTTGGACTCCTATTCCAATCAAGGAGCAGCTGCGTTTTGGCCCGAAGTTGAGATGCTTTCTACGTTTCGGCACTGTAATATTGTATCTTTGATTGGTTATTGTAATCAGGGAGATGAGATGATCCTTGTTTATGAATATATACCAAATGGATCACTATATGATCATTTACATAATCTTGGTACCCATCTTTCTTGGCTTCAGCGACTCAGTATCTGCATAGATGC


Protein sequences

Name Description Sequence
Aan.10340 translated coding region predicted by ESTScan from UniGene Aan.10340

XGFLTKESDVYSFGVVLCDVLCGRLCMVDDKFQPLVGLTRQSFRQNTVNQIVLTNIRDEINPNSLDVFSKVAYQCLKLERDERPLITEIVRELEAALQCQVSEPSTSFSFSSPSPSDSSSYSSIKRSQPCRRFQFHEIQLATKNFDETLLVGRGAFRKVYKGKIFDGSSLVMAAIKRLDSYSNQGAAAFWPEVEMLSTFRHCNIVSLIGYCNQGDEMILVYEYIPNGSLYDHLHNLGTHLSWLQRLSICIDA

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-122 Protein kinase-like (PK-like)
Protein kinase-like domain

GFLTKESDVYSFGVVLCDVLCGRLCMVDDKFQPLVGLTRQSFRQNTVNQIVLTNIRDEINPNSLDVFSKVAYQCLKLERDERPLITEIVRELEAALQCQVSEPSTSFSFSSPSPSDSSSYS

HMMPfam: PF07714
IPR001245
4-93 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LTKESDVYSFGVVLCDVLCGRLCMVDDKFQPLVGLTRQSFRQNTVNQIVLTNIRDEINPNSLDVFSKVAYQCLKLERDERPLITEIVREL

Gene3D: G3DSA:1.10.510.10
5-123 no description

TKESDVYSFGVVLCDVLCGRLCMVDDKFQPLVGLTRQSFRQNTVNQIVLTNIRDEINPNSLDVFSKVAYQCLKLERDERPLITEIVRELEAALQCQVSEPSTSFSFSSPSPSDSSSYSS

Seg: seg
102-129 seg

SEPSTSFSFSSPSPSDSSSYSSIKRSQP

HMMPanther: PTHR24420:SF418
114-252 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SPSDSSSYSSIKRSQPCRRFQFHEIQLATKNFDETLLVGRGAFRKVYKGKIFDGSSLVMAAIKRLDSYSNQGAAAFWPEVEMLSTFRHCNIVSLIGYCNQGDEMILVYEYIPNGSLYDHLHNLGTHLSWLQRLSICIDA

HMMPanther: PTHR24420
114-252 FAMILY NOT NAMED,FAMILY NOT NAMED

SPSDSSSYSSIKRSQPCRRFQFHEIQLATKNFDETLLVGRGAFRKVYKGKIFDGSSLVMAAIKRLDSYSNQGAAAFWPEVEMLSTFRHCNIVSLIGYCNQGDEMILVYEYIPNGSLYDHLHNLGTHLSWLQRLSICIDA

Gene3D: G3DSA:3.30.200.20
125-224 no description

KRSQPCRRFQFHEIQLATKNFDETLLVGRGAFRKVYKGKIFDGSSLVMAAIKRLDSYSNQGAAAFWPEVEMLSTFRHCNIVSLIGYCNQGDEMILVYEYI

superfamily: SSF56112
IPR011009
134-252 Protein kinase-like (PK-like)
Protein kinase-like domain

QFHEIQLATKNFDETLLVGRGAFRKVYKGKIFDGSSLVMAAIKRLDSYSNQGAAAFWPEVEMLSTFRHCNIVSLIGYCNQGDEMILVYEYIPNGSLYDHLHNLGTHLSWLQRLSICIDA

ProfileScan: PS50011
IPR000719
145-252 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDETLLVGRGAFRKVYKGKIFDGSSLVMAAIKRLDSYSNQGAAAFWPEVEMLSTFRHCNIVSLIGYCNQGDEMILVYEYIPNGSLYDHLHNLGTHLSWLQRLSICIDA

HMMPfam: PF07714
IPR001245
151-251 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VGRGAFRKVYKGKIFDGSSLVMAAIKRLDSYSNQGAAAFWPEVEMLSTFRHCNIVSLIGYCNQGDEMILVYEYIPNGSLYDHLHNLGTHLSWLQRLSICID






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox