PRGDB00064725 (Aan.10589)

From PRG Wiki
Jump to: navigation, search
Aan.10589
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159647564 (EY111977)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

CAZI761.rev CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI761 3', mRNA sequence

DNA Sequence

AGGGAAACATTGAATGGTTATGAACATGAATTAACCTTACAAAAGTATTAAATAGTTTTTCGAGCCTACAATTGTTCAGCCTCACAAGTTTATACAACATTTTCTGACCAAAAGGAAACGCATATCGAAACTTCTGTCAGAAATCTACCTAAGAATCTTTATCTTAGGATGGGCTATGTATAAGATCTAGACGAATAGTTAAATCTAACAGTTGACCAATAGTACCAAATGGCTTTCATGAGTGTGCACTTATCGTTACCACACAAAATGCTACAGATATATGCAGACGAACCAAAAGATGATAGATGCAACCAATATTTAACCTTTGATCCATCATAAAAGCTCCGCCTCTTCAGGATCACCATCACCGTCATCCACATCATTGTCCTCCTCTTCTTCAGGGGCATCTGGATCAACTCCCTTCATCAGCTTCTCTAATCGTTCCAACCCTTTCTTTGCTGCTTCATTTAAGGGGTTAATCCTCAAAGCAGACTGGTAATGTGAGAGTGAATCTTGCATCATGTTTGTAGCAGCAAATACCTGGGCCAGCTTCACATGAAGTGAGTCATCAGCCCAGTCTTTGAGGTATCTCTCGAGTAGTGTTACTGCTTCGTAATTCCGACCTTCCATGACATGTAACTCGGCCAATGCTAATGCAGCTCCGAGGTAACCAGGTTCTAGTCTTAGCGCAGACTCGTAAAACTTCTTAGCCTTGTCTCTGCCACTAGAATTACTAGCATATACATCGCCCACAAGTTTTAGAGCCTTTGCTGATTGAGGCATGGCCTTCATTGC


Protein sequences

Name Description Sequence
Aan.10589 translated coding region predicted by ESTScan from UniGene Aan.10589

AMKAMPQSAKALKLVGDVYASNSSGRDKAKKFYESALRLEPGYLGAALALAELHVMEGRNYEAVTLLERYLKDWADDSLHVKLAQVFAATNMMQDSLSHYQSALRINPLNEAAKKGLERLEKLMKGVDPDAPEEEEDNDVDDGDGDPEEAELLXWIKG


Domains

Domain Start-End Description Sequence

ProfileScan: PS50293
IPR013026
1-77 TPR_REGION
Tetratricopeptide repeat-containing

AMKAMPQSAKALKLVGDVYASNSSGRDKAKKFYESALRLEPGYLGAALALAELHVMEGRNYEAVTLLERYLKDWADD

superfamily: SSF48452
1-133 TPR-like

AMKAMPQSAKALKLVGDVYASNSSGRDKAKKFYESALRLEPGYLGAALALAELHVMEGRNYEAVTLLERYLKDWADDSLHVKLAQVFAATNMMQDSLSHYQSALRINPLNEAAKKGLERLEKLMKGVDPDAPE

HMMPanther: PTHR12558
1-151 FAMILY NOT NAMED,CELL DIVISION CYCLE 16

AMKAMPQSAKALKLVGDVYASNSSGRDKAKKFYESALRLEPGYLGAALALAELHVMEGRNYEAVTLLERYLKDWADDSLHVKLAQVFAATNMMQDSLSHYQSALRINPLNEAAKKGLERLEKLMKGVDPDAPEEEEDNDVDDGDGDPEEAE

HMMPanther: PTHR12558:SF8
1-151 ANAPHASE PROMOTING COMPLEX SUBUNIT 7,ANAPHASE PROMOTING COMPLEX SUBUNIT 7

AMKAMPQSAKALKLVGDVYASNSSGRDKAKKFYESALRLEPGYLGAALALAELHVMEGRNYEAVTLLERYLKDWADDSLHVKLAQVFAATNMMQDSLSHYQSALRINPLNEAAKKGLERLEKLMKGVDPDAPEEEEDNDVDDGDGDPEEAE

Gene3D: G3DSA:1.25.40.10
IPR011990
6-113 no description
Tetratricopeptide-like helical

PQSAKALKLVGDVYASNSSGRDKAKKFYESALRLEPGYLGAALALAELHVMEGRNYEAVTLLERYLKDWADDSLHVKLAQVFAATNMMQDSLSHYQSALRINPLNEAA

HMMPfam: PF13432
26-77 TPR_16,Tetratricopeptide repeat

RDKAKKFYESALRLEPGYLGAALALAELHVMEGRNYEAVTLLERYLKDWADD

Seg: seg
44-53 seg

LGAALALAEL

ProfileScan: PS50005
IPR019734
77-110 TPR
Tetratricopeptide repeat

DSLHVKLAQVFAATNMMQDSLSHYQSALRINPLN

ProfileScan: PS50293
IPR013026
77-110 TPR_REGION
Tetratricopeptide repeat-containing

DSLHVKLAQVFAATNMMQDSLSHYQSALRINPLN

Seg: seg
126-151 seg

GVDPDAPEEEEDNDVDDGDGDPEEAE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox