PRGDB00064727 (Aan.11744)

From PRG Wiki
Jump to: navigation, search
Aan.11744
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159583753 (EY100721)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI24903.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI24903 5', mRNA sequence

DNA Sequence

GGAACCAGTACTTCCAGCAAGCGGGCGAATAGTAACACCAAATTTAAAATGTTTCACTTTTGCTGAACTAAGATCCGCAACACGAAACTTTCGGCCTGATACCATGCTAGGAGAAGGAGGTTTTGGTAGGGTTTTCAAAGGATGGGTGGACGGTGAAACTTACGCGCCGTCGAAAGTCGGAATTGGGATCGCTGTGGCTGTCAAGAAATCAAGTCCTGATAGTGCTCAAGGTCTTAAAGAATGGCAGGCAGAAGTGAAATTTTTGGGAAAATTCAGCCATCCAAATCTTGTAAAGCTTGTTGGATATTGTTGGGAAGACAGAGAATTCCTTCTTGTATATGAATATATGCAAAAGGGTAGTCTTGAAAACCATCTTTTTAAGAAAGGTGCAGAGCCACTCTCATGGTCCACAAGGATTAAAATAGCAACTGGAGCAGCACAAGGGCTTGCTTTTTTGCATACAACTGAAAAAACTGTTATTTATAGGGACTTTAAGTCCGCAAATATTTTATTAGATGGGGACTTCAATGCGAAGCTCTCCGATTTTGGACTAGCAAAGTTAGGTCCTGCAAATGGCGAGTCTCATGTCTCCACTGGTGTAGTCGGTACATATGGTTACGCAGCTCCAGAATATATCGCCACTGGTCATTTATATGTTAACAGCGACGTTTATGGTTTTGGAGTTGTACTATTAGAAATAATAACGGGTCTACGTGTACTTGACACTAATCGACCTGGCTCACAACATAATTTGGTCGACTGGGCTCGACCTGCATTGCCCGACAAAAGGAAACTAAAAAAGAT


Protein sequences

Name Description Sequence
Aan.11744 translated coding region predicted by ESTScan from UniGene Aan.11744

XEPVLPASGRIVTPNLKCFTFAELRSATRNFRPDTMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGYCWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITGLRVLDTNRPGSQHNLVDWARPALPDKRKLKKX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF531
2-268 SUBFAMILY NOT NAMED

EPVLPASGRIVTPNLKCFTFAELRSATRNFRPDTMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGYCWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITGLRVLDTNRPGSQHNLVDWARPALPDKRKLKK

HMMPanther: PTHR24420
2-268 FAMILY NOT NAMED,FAMILY NOT NAMED

EPVLPASGRIVTPNLKCFTFAELRSATRNFRPDTMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGYCWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITGLRVLDTNRPGSQHNLVDWARPALPDKRKLKK

superfamily: SSF56112
IPR011009
3-258 Protein kinase-like (PK-like)
Protein kinase-like domain

PVLPASGRIVTPNLKCFTFAELRSATRNFRPDTMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGYCWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITGLRVLDTNRPGSQHNLVDWARP

Gene3D: G3DSA:3.30.200.20
14-103 no description

PNLKCFTFAELRSATRNFRPDTMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGY

ProfileScan: PS50011
IPR000719
31-269 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDTMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGYCWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITGLRVLDTNRPGSQHNLVDWARPALPDKRKLKKX

HMMSmart: SM00220
IPR002290
31-256 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDTMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGYCWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITGLRVLDTNRPGSQHNLVDWA

HMMSmart: SM00219
IPR020635
31-266 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDTMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGYCWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITGLRVLDTNRPGSQHNLVDWARPALPDKRKL

HMMPfam: PF07714
IPR001245
35-237 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

TMLGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKKSSPDSAQGLKEWQAEVKFLGKFSHPNLVKLVGYCWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITG

PatternScan: PS00107
IPR017441
37-70 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGRVFKGWVDGETYAPSKVGIGIAVAVKK

Gene3D: G3DSA:1.10.510.10
104-262 no description

CWEDREFLLVYEYMQKGSLENHLFKKGAEPLSWSTRIKIATGAAQGLAFLHTTEKTVIYRDFKSANILLDGDFNAKLSDFGLAKLGPANGESHVSTGVVGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIITGLRVLDTNRPGSQHNLVDWARPALPD

PatternScan: PS00108
IPR008271
160-172 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKSANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox