PRGDB00064728 (Aan.11817)

From PRG Wiki
Jump to: navigation, search
Aan.11817
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159682360 (EY089143)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI18744.rev CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI18744 3', mRNA sequence

DNA Sequence

ACCAAAAAAGCTTGAATAATATTGATCCAATCCAAATTATATATAACTTAATCACTATTCTATTAATTTAATTATATTAAAACCAAAACTGAAAGTATAAACGGTTGAATGAGAGTAGATAATATCTCTAATGAGTGATTGGTTGCTTGTTGTCACTCAAATCACCTTCCTGTTTTCTTCTGCATCTCTGAGAACACTGTATCTGACTTGAATCCTTCAGTGCTGTCACTAATTGACGACGTGCCATTTCTTACTGCAGTTGACCCTGAGAATATGTCATCATCGGTTGTGGTTTGCTCTCCTTGCAGTAGAAACGGATGTTCTTGATTATCTGGAACGACCTCAACAACCGTTTTTTCAGCAGCTTGTTGTAAATCCAACGCAAACTCGAGCCCCCAAACTACCTCATCCATTGCTGGCAGTTCGCTACCTTGCTCTTTCAAACAACTTATTGCTACTATCCCGAACTGCCTTAAGCACTCGGGGGCAATCGCACCCCTCAGTTTTGGATCGACTATCTTATTCAAGGTCCCTTTCCGATAACTCAATTTCCCCCATTCTGCCAAACTCACTTGCTCTTTGGGCATCCCGGGAATCATAACAGGTCTTGCACACAGCACTTCAAGCAGAACAACTCCAAACGAGTAGACATCGGATTTATCTGTAAGTTGTTGAGTTCGGTAATATTCGGGATCTACATACCCAATACTACCCTTCACCACCGTGCTAACATGGTTTTGTGCTTGGTCTCTGGGACCTAGCTTTGACAAACCAAAGTC


Protein sequences

Name Description Sequence
Aan.11817 translated coding region predicted by ESTScan from UniGene Aan.11817

DFGLSKLGPRDQAQNHVSTVVKGSIGYVDPEYYRTQQLTDKSDVYSFGVVLLEVLCARPVMIPGMPKEQVSLAEWGKLSYRKGTLNKIVDPKLRGAIAPECLRQFGIVAISCLKEQGSELPAMDEVVWGLEFALDLQQAAEKTVVEVVPDNQEHPFLLQGEQTTTDDDIFSGSTAVRNGTSSISDSTEGFKSDTVFSEMQKKTGR

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.10.510.10
1-127 no description

DFGLSKLGPRDQAQNHVSTVVKGSIGYVDPEYYRTQQLTDKSDVYSFGVVLLEVLCARPVMIPGMPKEQVSLAEWGKLSYRKGTLNKIVDPKLRGAIAPECLRQFGIVAISCLKEQGSELPAMDEVV

superfamily: SSF56112
IPR011009
1-132 Protein kinase-like (PK-like)
Protein kinase-like domain

DFGLSKLGPRDQAQNHVSTVVKGSIGYVDPEYYRTQQLTDKSDVYSFGVVLLEVLCARPVMIPGMPKEQVSLAEWGKLSYRKGTLNKIVDPKLRGAIAPECLRQFGIVAISCLKEQGSELPAMDEVVWGLEF

ProfileScan: PS50011
IPR000719
1-157 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DFGLSKLGPRDQAQNHVSTVVKGSIGYVDPEYYRTQQLTDKSDVYSFGVVLLEVLCARPVMIPGMPKEQVSLAEWGKLSYRKGTLNKIVDPKLRGAIAPECLRQFGIVAISCLKEQGSELPAMDEVVWGLEFALDLQQAAEKTVVEVVPDNQEHPFL

HMMPfam: PF07714
IPR001245
1-71 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DFGLSKLGPRDQAQNHVSTVVKGSIGYVDPEYYRTQQLTDKSDVYSFGVVLLEVLCARPVMIPGMPKEQVS

HMMPanther: PTHR24420
1-202 FAMILY NOT NAMED,FAMILY NOT NAMED

DFGLSKLGPRDQAQNHVSTVVKGSIGYVDPEYYRTQQLTDKSDVYSFGVVLLEVLCARPVMIPGMPKEQVSLAEWGKLSYRKGTLNKIVDPKLRGAIAPECLRQFGIVAISCLKEQGSELPAMDEVVWGLEFALDLQQAAEKTVVEVVPDNQEHPFLLQGEQTTTDDDIFSGSTAVRNGTSSISDSTEGFKSDTVFSEMQKK

HMMPanther: PTHR24420:SF418
1-202 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DFGLSKLGPRDQAQNHVSTVVKGSIGYVDPEYYRTQQLTDKSDVYSFGVVLLEVLCARPVMIPGMPKEQVSLAEWGKLSYRKGTLNKIVDPKLRGAIAPECLRQFGIVAISCLKEQGSELPAMDEVVWGLEFALDLQQAAEKTVVEVVPDNQEHPFLLQGEQTTTDDDIFSGSTAVRNGTSSISDSTEGFKSDTVFSEMQKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox