PRGDB00064730 (Aan.12023)

From PRG Wiki
Jump to: navigation, search
Aan.12023
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259588630 (EZ399621)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Uganda Contig16116, mRNA sequence

DNA Sequence

GATGTATGGGGATACGGTGTCTTCTTGTACGAACTAATCACAGGCCGTCGCCCATTAGACAAAAATAGACCCAAGAACGAGCAGAAGCTTCTAGAATGGGTCAAGCCCTACCTAGACTCCAAAAAGTTCCGGCTAATAATTGACTCAAGACTCGAGGGTAAGTACTCACTGAAGTCAGCACAAAAGTTATCGATTATAGCCAATAGATGTTTGTCTAGAAACCCAAAGTCGAGGCCAAAGATGAGTGAGGTTCTTGAAATGGTTAACCAACTTATTGGTGGCCCGTCACAAGCACCAGGTGCCACGCCACCTCTCAAGAGTTCGGTCCCAGTTGCTATCGAGCCAAGGAAAGTTTTTGGGGGACCCACCAACGTAAGAAATTCTCATGAGGAGACAAAAAATAATCCTATGGATGTACATTATACAGAATCTCCTAGTGTTTCTAGAGTATGTCATCCAAGGCTTTTGGCAAGTTGCTGATTTCGAGTATTTGGTAAATGAGTTTTGCAGTGTATGGTAGGAGATGACGTTATTGCCCTTATCCATTAATGTGCATGCAGAAAGTCATGCTTTAAGTCGCTGCAGAAAACGTGGTGCGAGGTATAAAAGGGTGGTTTCGTGAAAAACTATAGGTGTCGTATCTTATCTTGTATCTTGTATCTTGCATATAAAACTTGTGTAACTTGTGTTGATTATAGGAAGTTGATTTTGGTTTCCTCACTCTCTTGGCAACCGATAATGTTTCTGGACTCCAAATATGCAAGAACAAAGACGCGAAACCTCGCGAT


Protein sequences

Name Description Sequence
Aan.12023 translated coding region predicted by ESTScan from UniGene Aan.12023

DVWGYGVFLYELITGRRPLDKNRPKNEQKLLEWVKPYLDSKKFRLIIDSRLEGKYSLKSAQKLSIIANRCLSRNPKSRPKMSEVLEMVNQLIGGPSQAPGATPPLKSSVPVAIEPRKVFGGPTNVRNSHEETKNNPMDVHYTESPSVSRVCHPRLLASC

Domains

Domain Start-End Description Sequence

HMMPfam: PF00069
IPR017442
1-86 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DVWGYGVFLYELITGRRPLDKNRPKNEQKLLEWVKPYLDSKKFRLIIDSRLEGKYSLKSAQKLSIIANRCLSRNPKSRPKMSEVLE

superfamily: SSF56112
IPR011009
1-134 Protein kinase-like (PK-like)
Protein kinase-like domain

DVWGYGVFLYELITGRRPLDKNRPKNEQKLLEWVKPYLDSKKFRLIIDSRLEGKYSLKSAQKLSIIANRCLSRNPKSRPKMSEVLEMVNQLIGGPSQAPGATPPLKSSVPVAIEPRKVFGGPTNVRNSHEETKN

Gene3D: G3DSA:1.10.510.10
1-87 no description

DVWGYGVFLYELITGRRPLDKNRPKNEQKLLEWVKPYLDSKKFRLIIDSRLEGKYSLKSAQKLSIIANRCLSRNPKSRPKMSEVLEM

ProfileScan: PS50011
IPR000719
1-92 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DVWGYGVFLYELITGRRPLDKNRPKNEQKLLEWVKPYLDSKKFRLIIDSRLEGKYSLKSAQKLSIIANRCLSRNPKSRPKMSEVLEMVNQLI

HMMPanther: PTHR24420
1-92 FAMILY NOT NAMED,FAMILY NOT NAMED

DVWGYGVFLYELITGRRPLDKNRPKNEQKLLEWVKPYLDSKKFRLIIDSRLEGKYSLKSAQKLSIIANRCLSRNPKSRPKMSEVLEMVNQLI

HMMPanther: PTHR24420:SF643
1-92 PROTEIN KINASE, PUTATIVE

DVWGYGVFLYELITGRRPLDKNRPKNEQKLLEWVKPYLDSKKFRLIIDSRLEGKYSLKSAQKLSIIANRCLSRNPKSRPKMSEVLEMVNQLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox