PRGDB00064731 (Aan.12128)

From PRG Wiki
Jump to: navigation, search
Aan.12128
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159611861 (EY090528)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

CAZI19426.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI19426 5', mRNA sequence

DNA Sequence

CTAACAGAAAAAGACCAGAAGCGTGAACAAATTGTCCTCTAATACATTTCAAAGTCTGCAGCATCAAACTATGAGTGGTGAAGGGAAAGTGGTTTGTGTGACAGGTGCTTCCGGCTTCATTGCTTCATGGCTCGTTAAGCTCTTGCTGGCTCGTGGCTACTCCGTTCATGCTACTGTTCGATCACTTGGTGATCCGAAAAAGACAGAACATTTACTTGCTCTCGATGGAGCTAAAGAAAGACTATCTTTGTTTGAAGCTAACTTGACTGAAGACGGTTCTTTCGACTCTGCAGTTAAAGGCTGCATATGCGTCTTTCACACAGCATCTCCTGTTCATCTTGTAGTTGATGACCCACAGGCGCAATTGATAGATCCTGCAGTGAAGGGGACACTTAATGTTCTTAAGTCAGCTTCAAAAGTTCCATCTCTCAGAAGAGTTGTCTTGACATCTTCCATGGCTACAGTTTCGTACGGTGCAAAAGTTCCAGTGTTTGGTGATGTGGTCGATGAAACCTGGTTTTCAGATCCAATAGTTTGTCAAACAAAAAATTTGTGGTATGTCGTTTCGAAGATTATGGCTGAGGATGCTGCTGTAAAGTTTTCACAAGAGAACGGTATGGATTTGGTGTCGATAAATCCTGGCTATGTGATTGGTCCTATCTTACAGCCAACTCTCAACGTCACTTCTGAGGCATTCATGAACTTTATAAAAACCGGAGAGGATGTATTTTCAGATAGAGTCTATATACTTGTTGATAT


Protein sequences

Name Description Sequence
Aan.12128 translated coding region predicted by ESTScan from UniGene Aan.12128

MSGEGKVVCVTGASGFIASWLVKLLLARGYSVHATVRSLGDPKKTEHLLALDGAKERLSLFEANLTEDGSFDSAVKGCICVFHTASPVHLVVDDPQAQLIDPAVKGTLNVLKSASKVPSLRRVVLTSSMATVSYGAKVPVFGDVVDETWFSDPIVCQTKNLWYVVSKIMAEDAAVKFSQENGMDLVSINPGYVIGPILQPTLNVTSEAFMNFIKTGEDVFSDRVYILVDX

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
1-222 NAD(P)-binding Rossmann-fold domains

MSGEGKVVCVTGASGFIASWLVKLLLARGYSVHATVRSLGDPKKTEHLLALDGAKERLSLFEANLTEDGSFDSAVKGCICVFHTASPVHLVVDDPQAQLIDPAVKGTLNVLKSASKVPSLRRVVLTSSMATVSYGAKVPVFGDVVDETWFSDPIVCQTKNLWYVVSKIMAEDAAVKFSQENGMDLVSINPGYVIGPILQPTLNVTSEAFMNFIKTGEDVFSD

HMMPanther: PTHR10366
1-217 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MSGEGKVVCVTGASGFIASWLVKLLLARGYSVHATVRSLGDPKKTEHLLALDGAKERLSLFEANLTEDGSFDSAVKGCICVFHTASPVHLVVDDPQAQLIDPAVKGTLNVLKSASKVPSLRRVVLTSSMATVSYGAKVPVFGDVVDETWFSDPIVCQTKNLWYVVSKIMAEDAAVKFSQENGMDLVSINPGYVIGPILQPTLNVTSEAFMNFIKTGE

HMMPanther: PTHR10366:SF9
1-217 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

MSGEGKVVCVTGASGFIASWLVKLLLARGYSVHATVRSLGDPKKTEHLLALDGAKERLSLFEANLTEDGSFDSAVKGCICVFHTASPVHLVVDDPQAQLIDPAVKGTLNVLKSASKVPSLRRVVLTSSMATVSYGAKVPVFGDVVDETWFSDPIVCQTKNLWYVVSKIMAEDAAVKFSQENGMDLVSINPGYVIGPILQPTLNVTSEAFMNFIKTGE

Gene3D: G3DSA:3.40.50.720
IPR016040
6-220 no description
NAD(P)-binding domain

KVVCVTGASGFIASWLVKLLLARGYSVHATVRSLGDPKKTEHLLALDGAKERLSLFEANLTEDGSFDSAVKGCICVFHTASPVHLVVDDPQAQLIDPAVKGTLNVLKSASKVPSLRRVVLTSSMATVSYGAKVPVFGDVVDETWFSDPIVCQTKNLWYVVSKIMAEDAAVKFSQENGMDLVSINPGYVIGPILQPTLNVTSEAFMNFIKTGEDVF

HMMPfam: PF01370
IPR001509
8-205 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGFIASWLVKLLLARGYSVHATVRSLGDPKKTEHLLALDGAKERLSLFEANLTEDGSFDSAVKGCICVFHTASPVHLVVDDPQAQLIDPAVKGTLNVLKSASKVPSLRRVVLTSSMATVSYGAKVPVFGDVVDETWFSDPIVCQTKNLWYVVSKIMAEDAAVKFSQENGMDLVSINPGYVIGPILQPTLNVT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox