PRGDB00064733 (Aan.12178)

From PRG Wiki
Jump to: navigation, search
Aan.12178
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259850094 (EZ210372)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig7383.Aylt mRNA sequence

DNA Sequence

GACCCCAAAAACCTAGTAGTGGGCATTCCATCGATTCTTCATCAAAGATACAGTCGAGTTCGTTTCAGTAAACACTTGTGATGGACCAGTATGAGAAGGTTGAGAAGATCGGTGAAGGAACATATGGTGTGGTCTACAAAGCTCGTGACAAGGTTACGAACGAGACTATTGCTTTGAAGAAGATTCGTCTTGAGCAAGAGGATGAAGGAGTGCCAAGCACTGCTATCAGAGAGATTTCGCTGCTGAAAGAGATGCAGCATGGAAACATTGTCAGGTTACAGGATGTCGTACACAGTGACAAACGATTGTATCTGGTTTTCGAGTATCTGGACCTGGATTTGAAGAAACACATGGACTCTTGTCCAGAGTTTTCAAAGGATCCTCGTCTTGTAAAAATGTTTCTATATCAAATCCTACGTGGCATTGCTTATTGCCATTCTCATAGAGTTCTCCATAGAGACCTAAAGCCTCAGAATCTGTTGATTGACCGTCGTACCAACGCTTTAAAGCTGGCAGACTTTGGATTGGCCAGGGCCTTTGGTATCCCTGTCAGGACATTCACACACGAGGTGGTGACATTGTGGTATAGAGCACCAGAAATTCTTCTTGGATCCCGTCACTATTCCACTCCTGTTGATGTGTGGTCGGTTGGTTGTATATTTGCTGAGATGGTGAACCAGCGGCCACTCTTTCCTGGAGACTCTGAGATTGATGAACTATTCAAGATTTTCAGAATCATGGGAACTCCCACTGAAGATACATGGCCTGGTGTGACAACTCTGCCTGATTTCAAGTCCGCCTTCCCGAAGTGGTCTTCAAAGGACTTGGCATCTATTGTCCCAAATCTTGAAAAAACTGGCCTTGATCTCCTACGGAAAATGCTGTGCTTGGATCCCAGCAGAAGAGTTACAGCCAGGGCTGCACTGGAGCATGAATATTTCAAGGACATTGGGTTTGTGCCATAATTTATCAGGTTCTTATGTCCAAAACCAAAACCTTTATGGATTATTATGTGAGATATGCGTGCTGTCTTTAGGTAAAtttttttgttttCATTTCTTCTTCCATCTAGGACAAAGTAACGTTAAGATGCTTTCTTGCAAAGCCATTGTCGAATTGGCTTGTGCATCTGTCTTATATCTTCATCTGAAATCCTGTTTTCGAGTACGGAAAGAAGTTTATCAAATTTCTTGTAACAGTTTTCTTGATGGAGAACATATCATCAGGGTTTTTATTTCCTTTCAATGGAGTTGTTTGGTGTGCAATTTTCTTGTGTTTTCCAGTTGGTCAATGAATTGGATGGTTTCTTTGCGACC


Protein sequences

Name Description Sequence
Aan.12178 translated coding region predicted by ESTScan from UniGene Aan.12178

XPQKPSSGHSIDSSSKIQSSSFQXTLVMDQYEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYLVFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYFKDIGFVP

Domains

Domain Start-End Description Sequence

Seg: seg
6-21 seg

SSGHSIDSSSKIQSSS

HMMPanther: PTHR24056:SF109
11-317 SUBFAMILY NOT NAMED,SHAGGY-RELATED PROTEIN KINASE

IDSSSKIQSSSFQXTLVMDQYEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYLVFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYFKDI

HMMPanther: PTHR24056
11-317 FAMILY NOT NAMED,CELL DIVISION PROTEIN KINASE

IDSSSKIQSSSFQXTLVMDQYEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYLVFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYFKDI

superfamily: SSF56112
IPR011009
17-321 Protein kinase-like (PK-like)
Protein kinase-like domain

IQSSSFQXTLVMDQYEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYLVFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYFKDIGFVP

Gene3D: G3DSA:3.30.200.20
25-105 no description

TLVMDQYEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYL

ProfileScan: PS50011
IPR000719
31-314 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYLVFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYF

HMMPfam: PF00069
IPR017442
31-314 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYLVFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYF

HMMSmart: SM00220
IPR002290
31-314 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYLVFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYF

HMMSmart: SM00219
IPR020635
31-314 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSDKRLYLVFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYF

PatternScan: PS00107
IPR017441
37-60 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGTYGVVYKARDKVTNETIALK

Gene3D: G3DSA:1.10.510.10
106-315 no description

VFEYLDLDLKKHMDSCPEFSKDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRIMGTPTEDTWPGVTTLPDFKSAFPKWSSKDLASIVPNLEKTGLDLLRKMLCLDPSRRVTARAALEHEYFK

PatternScan: PS00108
IPR008271
150-162 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDLKPQNLLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox