PRGDB00064735 (Aan.12342)

From PRG Wiki
Jump to: navigation, search
Aan.12342
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159699431 (EY074686)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI11387.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI11387 5', mRNA sequence

DNA Sequence

GGAATATTAAGATTACGAATTGGCAAAGAGGGGAGCTTTTGGGACGTGGGTCGTTTGGGTCCGTTTATGAAGGCATTTGCGATGGTGGATATTTTATTGCTGTGAAGGAAGTTTCGTTGCTGGATTCGGGGGAATTAGGAAGGCAAAGCGTTGTCCAGCTTGAACAGGAAATTGCTCTTTTAAGTCAGTTTGAACATGAGAACATAGTACGATACTATGGGACTGATAAGGATGAGTCGAAGCTGTATATATTTCTTGAGCTTGTAACAAAAGGTTCCCTATTAAGTCTCTACCAGAGATATCATCTTCAAGATTGTCAAGTTTCCTCATACACACGGCAGATCTTACATGGTCTGAAGTATCTACATGATCGAAGTGTCGTTCACAGGGATGTAAAATGTGCAAATATCTTGGTGGACGCTAATGGCTCAGTGAAACTTGCAGATTTTGGGTTGGCAAAGGCCACTAAGTTCAATGATGTGAGGTCTTGCAAGGGAACCGCATTCTGGATGGCTCCCGAGGTTGTCAATCAAAAGAATAAGGGGTATGGACTTGCAGCTGACATTTGGAGCCTTGGTTGCACTGTCTTGGAGATGTTGACACGTCGGATTCCTTACTCCCCAATGGAATGTATGGCTGCGTTATTTAGAATAGGAAGTGGTATTGCTCCACCTGTTCCTGATTCTCTTTCTAAAGAAGCAAAGGAT


Protein sequences

Name Description Sequence
Aan.12342 translated coding region predicted by ESTScan from UniGene Aan.12342

XNIKITNWQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILHGLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIAPPVPDSLSKEAKD

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
3-236 Protein kinase-like (PK-like)
Protein kinase-like domain

IKITNWQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILHGLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIAPPVPDSLSKEAKD

Gene3D: G3DSA:3.30.200.20
3-117 no description

IKITNWQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILH

ProfileScan: PS50011
IPR000719
8-236 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILHGLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIAPPVPDSLSKEAKD

HMMPfam: PF00069
IPR017442
8-223 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

WQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILHGLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIA

HMMPanther: PTHR24361
8-236 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

WQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILHGLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIAPPVPDSLSKEAKD

HMMSmart: SM00220
IPR002290
8-236 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

WQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILHGLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIAPPVPDSLSKEAKD

HMMPanther: PTHR24361:SF63
8-236 SUBFAMILY NOT NAMED

WQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILHGLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIAPPVPDSLSKEAKD

HMMSmart: SM00219
IPR020635
8-234 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

WQRGELLGRGSFGSVYEGICDGGYFIAVKEVSLLDSGELGRQSVVQLEQEIALLSQFEHENIVRYYGTDKDESKLYIFLELVTKGSLLSLYQRYHLQDCQVSSYTRQILHGLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIAPPVPDSLSKEA

PatternScan: PS00107
IPR017441
14-36 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGSFGSVYEGICDGGYFIAVK

Gene3D: G3DSA:1.10.510.10
118-236 no description

GLKYLHDRSVVHRDVKCANILVDANGSVKLADFGLAKATKFNDVRSCKGTAFWMAPEVVNQKNKGYGLAADIWSLGCTVLEMLTRRIPYSPMECMAALFRIGSGIAPPVPDSLSKEAKD

PatternScan: PS00108
IPR008271
127-139 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDVKCANILV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox