PRGDB00064742 (Aan.12800)

From PRG Wiki
Jump to: navigation, search
Aan.12800
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159697541 (EY111430)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI733.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI733 5', mRNA sequence

DNA Sequence

TGAACCGTGCTCTAAACTCGAGGACCTAAACTTGGAGGTCAAAAGAAGCTCCCTTGACAAGGATAAAGAGGATCTTGATGGAGACACTTTTACGAGGAAAGATGATTCCCATGTGCCAATTCATGAAGTTATATTTTCAGCTGTTGACAAGCCTAAGCTTCTCAGTCAGCTGTCAGCGTTACTTTCTGACATAGGACTCAACATACGTGAAGCACATGTGTTTTCAACAACTGATGGTTATTCTTTGGATGTGTTTGTGGTTGATGGATGGCCTCTCCAGGAATCACAGGCTTTACAGGCAGCAATGGAGAGAGCAATTGCTAGGAGCGAGGGTTCATGGTCTGGTTCTTCACGGTCAAAATCAGGCATAGAGAGAGCACTAGCTGCTCCACCCAATATTGTAGATACAGAGATAGATATACGATTACTTAAAGTAGGGGAAAAAGTTGCATCAGGATCTTGTGGTGATTTGCACCGAGGAGTGTATCTTGGTCAGGATGTTGCTGTTAAAATTCTAAGATCTGAGACACTGAATGAAGCATTGGAGGATGAATTCCGCCATGAAGTAGCCATTCTCAGGGAGGTCCAACATAAAAATGTTGTTCGTTTTATTGGTGCTTGTACAAAGCAACCTTACATGTGCATAGTAACAGAATACATGCCTGGAGGCAGCCTTTATGAATATCTACATAAGAACCATCACACCTTGACAATTCCCCAGTTGGTGCAGTTTGCAATAGACGTTTGTAGAGGAATGGAGTACTTGCATAAGAGCAATATCATCCATAGGGACCTGAAGACTGCAAACTTGCTTATGGACAGTGATAATGTTTGTAAGGTGGC


Protein sequences

Name Description Sequence
Aan.12800 translated coding region predicted by ESTScan from UniGene Aan.12800

XEPCSKLEDLNLEVKRSSLDKDKEDLDGDTFTRKDDSHVPIHEVIFSAVDKPKLLSQLSALLSDIGLNIREAHVFSTTDGYSLDVFVVDGWPLQESQALQAAMERAIARSEGSWSGSSRSKSGIERALAAPPNIVDTEIDIRLLKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIGACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKVA

Domains

Domain Start-End Description Sequence

superfamily: SSF55021
37-114 ACT-like

SHVPIHEVIFSAVDKPKLLSQLSALLSDIGLNIREAHVFSTTDGYSLDVFVVDGWPLQESQALQAAMERAIARSEGSW

HMMPfam: PF01842
IPR002912
42-89 ACT
Amino acid-binding ACT

HEVIFSAVDKPKLLSQLSALLSDIGLNIREAHVFSTTDGYSLDVFVVD

Gene3D: G3DSA:3.30.70.260
47-106 no description

SAVDKPKLLSQLSALLSDIGLNIREAHVFSTTDGYSLDVFVVDGWPLQESQALQAAMERA

Seg: seg
110-123 seg

SEGSWSGSSRSKSG

superfamily: SSF56112
IPR011009
116-282 Protein kinase-like (PK-like)
Protein kinase-like domain

GSSRSKSGIERALAAPPNIVDTEIDIRLLKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIGACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKVA

Gene3D: G3DSA:3.30.200.20
131-206 no description

PPNIVDTEIDIRLLKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIG

HMMPanther: PTHR23257:SF82
IPR015783
138-282 PROTEIN KINASE ATMRK1,Ser-thr,PROTEIN KINASE ATMRK1
Serine/threonine protein kinase-like, ATMRK

EIDIRLLKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIGACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKVA

HMMPanther: PTHR23257
138-282 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

EIDIRLLKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIGACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKVA

HMMPfam: PF07714
IPR001245
144-282 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIGACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKVA

ProfileScan: PS50011
IPR000719
144-282 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIGACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKVA

HMMSmart: SM00220
IPR002290
144-281 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIGACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKV

HMMSmart: SM00219
IPR020635
144-282 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LKVGEKVASGSCGDLHRGVYLGQDVAVKILRSETLNEALEDEFRHEVAILREVQHKNVVRFIGACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKVA

Gene3D: G3DSA:1.10.510.10
207-282 no description

ACTKQPYMCIVTEYMPGGSLYEYLHKNHHTLTIPQLVQFAIDVCRGMEYLHKSNIIHRDLKTANLLMDSDNVCKVA

PatternScan: PS00108
IPR008271
261-273 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTANLLM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox