PRGDB00064754 (Aan.13846)

From PRG Wiki
Jump to: navigation, search
Aan.13846
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259821259 (EZ381467)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Uganda Contig14918.Ulm mRNA sequence

DNA Sequence

GGCGAAAACAAATATTGATACACAATTTTCTTTTCTACTTTAGGGAATGCAGAGAGATGATTGTAGACTCGCGGCTGTTTAACCGTGGTAGAACCCAACAACCTATCGGCGGCAGAACGTGCCACCGCAAGCACGTTGAAGACGGGTGAACTATATTCACCCGTGGCAACCGGTCACacttttagtatcattttcactttctttttttCAGAAAGCCAAATATTCACACACCTATCGTACGTTTTATAACATTTCCTAGTACAATTATTTCCTTTTACTTAAATTTGAACCCGCAACCTTTTAAGATGTCTTCAGAAGATAGAACCAATGGTGTGCTCAACGGCAAATACGAGCTCGGCCGTCAGCTAGGCCACGGTACATTTGCGAAAGTGTACCACGCGAAAAACGTGCATACCGGTAAAAGTGTAGCAATGAAAATTGTTGAGACAAGAAAAGGTTATAAAAGTCGGAATGATGGACCAGATCAAGCGCGAGATCTCGGTTATGAAGATGGTACGACATCCAAATATAGTCGAATTATACGAGGTGATGGCAAGTAAATCCAAGATTTATTTCGCTATGGAGCTTGTGAGAGGCGGAGAGTTGTTTTCGAAAATAGCTAAAGGCAGACTTCGCGAAGAAGTTGCTAGAAGCTATTTTCAACAGCTGATTTCAGCTGTTGATTTTTGTCATAGTCGCGGTGTGTACCACCGCGACCTGAAGCCAGAAAACCTCTTACTTGATGAAGAAGGTAACTTAAAGGTTACAGATTTCGGTCTAAGCGCGTTTTGTGACCATCTTAGACAAGATGGCTTGCTACACACAACTTGTGGTACTCCTGCTTATGTTGCACCAGAAATAATAGGAAAAAAAGGTTATGACGGCGCTAAGGCGGATATTTGGTCATGTGGAGTCATTCTCTACGTTCTTCTCGCAGGGTTCTTACCGTTTCAAGATGAAAACATTGTAGCCATGTATCGGAAGATCTACCGGGGCGACTTCAAGTGCCCGCCCTGGTTCTCATCCGATGCGCGAAAACTAATCACTAAACTCCTTGATCCGAACCCGAGTACCCGAATATCAATCTCCAAAATCATGGAGTCTAGCTGGTTCAAGAAAACTGCACCAAAGAAGAATGCTAACTTTTTAATCGAAGACGAGGGCGGACAAGTACAATCTAAAGGTATTGAATCGAAAACCCTAAACGCATTTCATATAATTTCCTTATCCGAAGGGTTCGACTTATCTCCCTTATTCgaagagaaaaagagagaagaaaaagaagaaaTGAGATTTGCAACAACCGAGTCAGCTACAACGGTCATGTCGAAGCTAGAAGAAGTTGCGAAATCGGGTAAATTTAGTGTGAAAAAAAGTGGGGACGAAAGTAGTCTAAGGTTACAAGGGAATGAAGCGGGAAGAAAAGGAAAGCTAGGTATCGCGGCTGAGTTATTCGCAGTCACGCCTTCGTTTTTAGTTGTTGAAGTTAAGAAATCGAGTGGCGATACATTGGAGTATAATCAGTTCTGTAGTAACGAGCTCCGGCCAGCGCTCAGGGATATCGTGTGGCGCTCTGCGGCCGGACACTCGTTTCCGGCTTGAACTAAATCATTGATTTCAAGTTTGTTGTTAtgtttttgtaaagttgttattaaatgtgtcatgtggtttctgttttgtttttaaaaattatgtCTTGGAATCGTTGTTCATGTGACTTTGAGATCAttttcggttttttgaatcttttgtatatcctttatgtatttttttAATGATCATGGTTGTTTTGTC


Protein sequences

Name Description Sequence
Aan.13846 translated coding region predicted by ESTScan from UniGene Aan.13846

MSSEDRTNGVLNGKYELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLREEVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWFKKTAPKKNANFLIEDEGGQVQSKGIESKTLNAFHIISLSEGFDLSPLFEEKKREEKEEMRFATTESATTVMSKLEEVAKSGKFSVKKSGDESSLRLQGNEAGRKGKLGIAAELFAVTPSFLVVEVKKSSGDTLEYNQFCSNELRPALRDIVWRSAAGHSFPA

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-300 Protein kinase-like (PK-like)
Protein kinase-like domain

MSSEDRTNGVLNGKYELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLREEVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWFKKTAPKKNANFLIEDEGGQVQSKGIESKTLN

Gene3D: G3DSA:3.30.200.20
4-111 no description

EDRTNGVLNGKYELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLRE

HMMPanther: PTHR24345
13-423 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK

GKYELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLREEVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWFKKTAPKKNANFLIEDEGGQVQSKGIESKTLNAFHIISLSEGFDLSPLFEEKKREEKEEMRFATTESATTVMSKLEEVAKSGKFSVKKSGDESSLRLQGNEAGRKGKLGIAAELFAVTPSFLVVEVKKSSGDTLEYNQFCSNELRPALRDIVWRS

HMMPanther: PTHR24345:SF45
13-423 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PLK1

GKYELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLREEVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWFKKTAPKKNANFLIEDEGGQVQSKGIESKTLNAFHIISLSEGFDLSPLFEEKKREEKEEMRFATTESATTVMSKLEEVAKSGKFSVKKSGDESSLRLQGNEAGRKGKLGIAAELFAVTPSFLVVEVKKSSGDTLEYNQFCSNELRPALRDIVWRS

HMMPfam: PF00069
IPR017442
15-269 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLREEVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWF

ProfileScan: PS50011
IPR000719
15-269 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLREEVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWF

HMMSmart: SM00219
IPR020635
15-269 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLREEVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWF

HMMSmart: SM00220
IPR002290
15-269 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRQLGHGTFAKVYHAKNVHTGKSVAMKIVETRKGYKSRNDGPDQAEISVMKMVRHPNIVELYEVMASKSKIYFAMELVRGGELFSKIAKGRLREEVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWF

PatternScan: PS00107
IPR017441
21-44 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGTFAKVYHAKNVHTGKSVAMK

Gene3D: G3DSA:1.10.510.10
112-280 no description

EVARSYFQQLISAVDFCHSRGVYHRDLKPENLLLDEEGNLKVTDFGLSAFCDHLRQDGLLHTTCGTPAYVAPEIIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENIVAMYRKIYRGDFKCPPWFSSDARKLITKLLDPNPSTRISISKIMESSWFKKTAPKKNANF

PatternScan: PS00108
IPR008271
133-145 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

ProfileScan: PS50816
IPR018451
294-318 NAF
NAF/FISL domain

IESKTLNAFHIISLSEGFDLSPLFE

HMMPfam: PF03822
IPR004041
296-356 NAF
NAF domain

SKTLNAFHIISLSEGFDLSPLFEEKKREEKEEMRFATTESATTVMSKLEEVAKSGKFSVKK

Seg: seg
318-327 seg

EEKKREEKEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox