PRGDB00064759 (Aan.14274)

From PRG Wiki
Jump to: navigation, search
Aan.14274
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159634471 (EY090967)
Gene Class Mlo-like
Domain Type MLO
Gene Species Artemisia annua

Comment?

CAZI19646.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI19646 5', mRNA sequence

DNA Sequence

GAAAAAGTGGTAAAGATTGGATTTTGATCATACCCTTTTTGATTTAATGGCGGGTGGTGAAGGTGAAGGTACTTCTTTAGAGTTTACTCCCACTTGGGTTGTTGCTGCTGTTTGTACTCTTATTGTTGGTATTTCACTTGCTGTTGAACGTTTGCTTCATTATGCTGGCAAGAAATTAAAGAAGGCAGGCCAAAAGCCACTCTTTGAAGCACTTCAAAAGATTAAAGAAGAGTTGATGTTGTTGGGGTTTATTTCACTTTTATTGACCGTCTTCCAATCAAGAATAATCAGAATATGCGTGAAAGAGGGTCTAATGAATCACCTTCTTCCATGTTCTTTGAGTGAAAGAGACGAGGCCTTGAATCCTAAACCCAAGAGTACGTCTCATTTTCGTCATTTGCTTGCTGAAGAAGAAGTAACAGCTGTGGGTTATTGTGCTGCAAAGGAAAAGGTCCCTCTCTTATCTCTCGAGGCATTGCATCATCTACACATCTTCATTTTCGTACTTGCTGTTGTGCACGTGACTTTTTCTGTCCTCACCGTTGTATTTGGCGGATTAAAGATACGACAATGGAAGAATTGGGAAGAATCTGTCGCGATAGTAAATTATGACCACTCACAAATGTTCAAGCCGAAGAAAGTCACCCATGTCAAAGATCATGACTTCATCAGGAATCGTTTCGTGGGTATTGGCAAAGGTTCAGCGATTAGAGGCTGGCTGCATTCTTTCTTCAAGCAATTCTACGGATCTGTCACCAAGACAGATTATGTAGCACTGCGTTTGGGATTTATAACTACGCATTGCAGGGCAAACCCGAAGTTC


Protein sequences

Name Description Sequence
Aan.14274 translated coding region predicted by ESTScan from UniGene Aan.14274

MAGGEGEGTSLEFTPTWVVAAVCTLIVGISLAVERLLHYAGKKLKKAGQKPLFEALQKIKEELMLLGFISLLLTVFQSRIIRICVKEGLMNHLLPCSLSERDEALNPKPKSTSHFRHLLAEEEVTAVGYCAAKEKVPLLSLEALHHLHIFIFVLAVVHVTFSVLTVVFGGLKIRQWKNWEESVAIVNYDHSQMFKPKKVTHVKDHDFIRNRFVGIGKGSAIRGWLHSFFKQFYGSVTKTDYVALRLGFITTHCRANPKF

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
7-259 Mlo
Mlo-related protein

EGTSLEFTPTWVVAAVCTLIVGISLAVERLLHYAGKKLKKAGQKPLFEALQKIKEELMLLGFISLLLTVFQSRIIRICVKEGLMNHLLPCSLSERDEALNPKPKSTSHFRHLLAEEEVTAVGYCAAKEKVPLLSLEALHHLHIFIFVLAVVHVTFSVLTVVFGGLKIRQWKNWEESVAIVNYDHSQMFKPKKVTHVKDHDFIRNRFVGIGKGSAIRGWLHSFFKQFYGSVTKTDYVALRLGFITTHCRANPKF

Seg: seg
156-168 seg

VVHVTFSVLTVVF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox