PRGDB00064766 (Aan.14569)

From PRG Wiki
Jump to: navigation, search
Aan.14569
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159637647 (EY113658)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI8460.rev CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI8460 3', mRNA sequence

DNA Sequence

CATTTATTTTTCGATAACAGATAAAATTTACAATTTACAAACAACTCTAAAAATACAGAACTACGTGATAGAAGAGTACAGAGATGGATCAACAACCTTATCTTTCATTCTTAATGAGGGGGGATCAAGATACACACTACAATATTTGTAAAGTAAAAACGACGAGAAAAAAGATGCATATGTACATAGAAAAAAATATTACTTCAAAATTTCACCACGTGTTGACAGGAACTTGAGTCTGGTTACAACTTGAAGCCGAAGCCTGATATCAGTGATCAAACCATTTGATTTGACTTATGGGAAGCGACCATACTATAAAATTCCTCACTAAAAAGTTCTTCATAGCGTTTCTTCAATGATGACCCGCGCTTGCAATTTCTCATAGCGAATTCCAGTCCAGCTTGTTCACCTCTTAAAAGCTGTAAAACCTGGTTCATATCTGGGCGCCGAATGGATGACCGTTGTATGCATAAAGATGCAGCCAAAACCGTCAAATGCAATTGTCGTTTGTTACAGCTGTCATCAATTGCAGGATCTACAAGCTCTCGAACATTGTTCTTCCTGAGCAATGGTTTCGCCCATAAAACAAGACTTTGTTGTGAGTAATCTAGAGCTCTACGACCACTAATAAGTTCCAATAAAAGTACACCAAATGCAAAAACATCAGTCTTTTCATCGACTATACCGTGCATCAAATACTCTGGAGCTAAATATCCGAATGTGCC


Protein sequences

Name Description Sequence
Aan.14569 translated coding region predicted by ESTScan from UniGene Aan.14569

GTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELISGRRALDYSQQSLVLWAKPLLRKNNVRELVDPAIDDSCNKRQLHLTVLAASLCIQRSSIRRPDMNQVLQLLRGEQAGLEFAMRNCKRGSSLKKRYEELFSEEFYSMVASHKSNQMV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-111 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELISGRRALDYSQQSLVLWAKPLLRKNNVRELVDPAIDDSCNKRQLHLTVLAASLCIQRSSIRRPDMNQVLQLLRGEQAGL

Gene3D: G3DSA:1.10.510.10
1-104 no description

GTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELISGRRALDYSQQSLVLWAKPLLRKNNVRELVDPAIDDSCNKRQLHLTVLAASLCIQRSSIRRPDMNQVLQLL

superfamily: SSF56112
IPR011009
1-147 Protein kinase-like (PK-like)
Protein kinase-like domain

GTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELISGRRALDYSQQSLVLWAKPLLRKNNVRELVDPAIDDSCNKRQLHLTVLAASLCIQRSSIRRPDMNQVLQLLRGEQAGLEFAMRNCKRGSSLKKRYEELFSEEFYSMVASHKSNQ

HMMPanther: PTHR24420
1-112 FAMILY NOT NAMED,FAMILY NOT NAMED

GTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELISGRRALDYSQQSLVLWAKPLLRKNNVRELVDPAIDDSCNKRQLHLTVLAASLCIQRSSIRRPDMNQVLQLLRGEQAGLE

HMMPanther: PTHR24420:SF794
1-112 SUBFAMILY NOT NAMED

GTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELISGRRALDYSQQSLVLWAKPLLRKNNVRELVDPAIDDSCNKRQLHLTVLAASLCIQRSSIRRPDMNQVLQLLRGEQAGLE

HMMPfam: PF07714
IPR001245
5-103 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

YLAPEYLMHGIVDEKTDVFAFGVLLLELISGRRALDYSQQSLVLWAKPLLRKNNVRELVDPAIDDSCNKRQLHLTVLAASLCIQRSSIRRPDMNQVLQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox