PRGDB00064808 (Aan.19637)

From PRG Wiki
Jump to: navigation, search
Aan.19637
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159633932 (EY058927)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

CATF11326.fwd CATF Artemisia annua, Tanzanian, from Sandeman Seeds, 1-2kb Artemisia annua cDNA clone CATF11326 5', mRNA sequence

DNA Sequence

TACCCAAAGAAACAAGAAACATTTGCTCGGATTTCTGGATACTGTGAGCAAAATGACATTCATTCACCTCACGTCACTGTTTACGAGTCTTTGATATACTCAGCCTGGCTCAGGTTGGCATCAGATGTAGACGAAAACCAAAGAAAGGCGTTTGTTGATCAAGTTATAGACCTTGTGGAACTGAACTCATTAAAGGATTCACTAGTAGGGTTGCCAGGTGTCAACGGTCTGTCAACAGAACAAAGAAAGAGGTTAACCATAGCGGTTGAGCTAGTGGCAAACCCGGCCATTATATTTATGGATGAGCCAACCTCTGGGCTAGATGCTAGAGCTGCTGCCATTGTGATGAGAACCGTTAGGAACACTGTGGACACAGGAAGAACAGTCGTTTGCACCATTCATCAACCTAGCATTGATATCTTTGAAGCTTTTGATGAGTTGTTCTTAATGAAAAGAGGAGGACAGGAGCTGTATGCTGGACCCATAGGTCGCAATTCCTGCGAGTTAATAGAGTACTTTGAGGCCATAAATGGCGTGAGTAAGATTACAGATGGATACAACCCCGCGACATGGATGTTGGAAGTCAGTACCTCAGCACAAGAAGCCGCTCTTGGAGTTGATTTCACTTCAATCTACAGAAATTCTGAACTTTACAAGAGAAACAAAG


Protein sequences

Name Description Sequence
Aan.19637 translated coding region predicted by ESTScan from UniGene Aan.19637

YPKKQETFARISGYCEQNDIHSPHVTVYESLIYSAWLRLASDVDENQRKAFVDQVIDLVELNSLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQELYAGPIGRNSCELIEYFEAINGVSKITDGYNPATWMLEVSTSAQEAALGVDFTSIYRNSELYKRNKX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF10
1-222 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

YPKKQETFARISGYCEQNDIHSPHVTVYESLIYSAWLRLASDVDENQRKAFVDQVIDLVELNSLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQELYAGPIGRNSCELIEYFEAINGVSKITDGYNPATWMLEVSTSAQEAALGVDFTSIYRNSELYKRNK

HMMPanther: PTHR19241
1-222 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

YPKKQETFARISGYCEQNDIHSPHVTVYESLIYSAWLRLASDVDENQRKAFVDQVIDLVELNSLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQELYAGPIGRNSCELIEYFEAINGVSKITDGYNPATWMLEVSTSAQEAALGVDFTSIYRNSELYKRNK

Gene3D: G3DSA:3.40.50.300
6-153 no description

ETFARISGYCEQNDIHSPHVTVYESLIYSAWLRLASDVDENQRKAFVDQVIDLVELNSLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRG

superfamily: SSF52540
8-161 P-loop containing nucleoside triphosphate hydrolases

FARISGYCEQNDIHSPHVTVYESLIYSAWLRLASDVDENQRKAFVDQVIDLVELNSLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQELYAGP

HMMPfam: PF00005
IPR003439
10-105 ABC_tran
ABC transporter-like

RISGYCEQNDIHSPHVTVYESLIYSAWLRLASDVDENQRKAFVDQVIDLVELNSLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPAIIFMDEPTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox