PRGDB00064813 (Aan.19855)

From PRG Wiki
Jump to: navigation, search
Aan.19855
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159664192 (EY062188)
Gene Class Mlo-like
Domain Type MLO
Gene Species Artemisia annua

Comment?

CATF497.fwd CATF Artemisia annua, Tanzanian, from Sandeman Seeds, 1-2kb Artemisia annua cDNA clone CATF497 5', mRNA sequence

DNA Sequence

CACTAATACTAGTAGTAACTCAGAAATCAATCTCCAAAATATGCATACCAAACAAAGTTGCAAATTCCATGCTTCCTTGTCACAAAATACTCAATGAAACATCACAAACAACCCAAGCATATGAAGTGGTCCGTTATGCTACCTCTACCCTATTTGAACCACGCGACTTTGACGAAGGCATCATGACTCAACCACAACACAGACTACTAGCTTCAACTTCCGCTACTTCTACAAATTCCACCGATCATTGTGCCTCAAAGGGGATGACATCTTTTATATCAGAACAAGGGATAAACCAGCTAAACACCTTCATATGTGTTTTGGCTATTATGCAAATAGTATATAGTGTTGCCACCATGCTTTTGGGGACAGCCAAGATGAAGAGTTGGAAAGCTTGGGAGCAAGAAACTCAAACTATAGAATACTTGGTGGCTAATGATCCCAACCGGTTTAGATTTACAAGGCAAACAACATTTGGGAAACGACATATGACTGATCCAATCGACACACCGATCTTATTGTGGATTAAGTGCTTCTTTCGACAATTCTTTCATTCAGTTGCTAAAGTCGACTATTTCACTTTACGTCATGGATTTATTTCGGCTCATCATCTATCGACAAACAACACTTTCAATTTCCGCAAGTACACACAACGCTCCTTAGAAGATGACTTCAAAGTTGTAGTTGGCATAAGTCCCTCTATGTGGTTTCTGCTAGTTATTCTCATGCTTATCGATGTCCATGGTTGGCATATGTATCCTTGGGGATCATTTC


Protein sequences

Name Description Sequence
Aan.19855 translated coding region predicted by ESTScan from UniGene Aan.19855

XLILVVTQKSISKICIPNKVANSMLPCHKILNETSQTTQAYEVVRYATSTLFEPRDFDEGIMTQPQHRLLASTSATSTNSTDHCASKGMTSFISEQGINQLNTFICVLAIMQIVYSVATMLLGTAKMKSWKAWEQETQTIEYLVANDPNRFRFTRQTTFGKRHMTDPIDTPILLWIKCFFRQFFHSVAKVDYFTLRHGFISAHHLSTNNTFNFRKYTQRSLEDDFKVVVGISPSMWFLLVILMLIDVHGWHMYPWGSFX

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
2-258 Mlo
Mlo-related protein

LILVVTQKSISKICIPNKVANSMLPCHKILNETSQTTQAYEVVRYATSTLFEPRDFDEGIMTQPQHRLLASTSATSTNSTDHCASKGMTSFISEQGINQLNTFICVLAIMQIVYSVATMLLGTAKMKSWKAWEQETQTIEYLVANDPNRFRFTRQTTFGKRHMTDPIDTPILLWIKCFFRQFFHSVAKVDYFTLRHGFISAHHLSTNNTFNFRKYTQRSLEDDFKVVVGISPSMWFLLVILMLIDVHGWHMYPWGSF

Seg: seg
71-81 seg

ASTSATSTNST






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox