PRGDB00064819 (Aan.20085)

From PRG Wiki
Jump to: navigation, search
Aan.20085
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159638589 (EY065331)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CATF8768.rev CATF Artemisia annua, Tanzanian, from Sandeman Seeds, 1-2kb Artemisia annua cDNA clone CATF8768 3', mRNA sequence

DNA Sequence

ACCGAAATCCTTAATACTCTATTGCGGCCGAGAAACAACATTTATTATCATTATTCAGACAAAATAGAAAAGACAGTAATTATAGAATGCTTCTGGCTCAATATCTGGAATACAGATCTATCTCACTTCCCTTCACTGCGCTCTTGTATTTCAAGTGCAATCTCAAGCTTTTCCACAACGAGAGACATTGTTGGCCGTTCTTCACGAGATGTATGCAAACATTGAAATGCAATGTCTGCAAATACATCCAAAGAAGAAGGATCCATTTGTTGCTTGAGATCTTCAAAGATAATCTCATCTAGttttttttGTTCATAGCTTTCTTTCCACAAAGGGACAAAAATATTTAACTGACCATTGCTATTTTCAACACATAGTCTCCCACATAGGACTTCTAACATGACTACTCCAAAAGAGTACACATCCGACTCCTTCGTTACGGAGTATGTCTCCATATAGACTGGATCACAGTACCCCGGTGTACCCACAATATCGCAGATAACAAAGGAGTTCTGCTTATCAATGGGGGCCATTTTTGACAACCCAAAACTAGAAACTTTAGCATTCAGATTTTCATTGAGCAGGATGTTGGCACTTTTAATGTCACAATGAAGTAGTCTT


Protein sequences

Name Description Sequence
Aan.20085 translated coding region predicted by ESTScan from UniGene Aan.20085

XRLLHCDIKSANILLNENLNAKVSSFGLSKMAPIDKQNSFVICDIVGTPGYCDPVYMETYSVTKESDVYSFGVVMLEVLCGRLCVENSNGQLNIFVPLWKESYEQKKLDEIIFEDLKQQMDPSSLDVFADIAFQCLHTSREERPTMSLVVEKLEIALEIQERSEGK

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-157 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XRLLHCDIKSANILLNENLNAKVSSFGLSKMAPIDKQNSFVICDIVGTPGYCDPVYMETYSVTKESDVYSFGVVMLEVLCGRLCVENSNGQLNIFVPLWKESYEQKKLDEIIFEDLKQQMDPSSLDVFADIAFQCLHTSREERPTMSLVVEKLEIAL

superfamily: SSF56112
IPR011009
2-161 Protein kinase-like (PK-like)
Protein kinase-like domain

RLLHCDIKSANILLNENLNAKVSSFGLSKMAPIDKQNSFVICDIVGTPGYCDPVYMETYSVTKESDVYSFGVVMLEVLCGRLCVENSNGQLNIFVPLWKESYEQKKLDEIIFEDLKQQMDPSSLDVFADIAFQCLHTSREERPTMSLVVEKLEIALEIQE

HMMPanther: PTHR24420
2-161 FAMILY NOT NAMED,FAMILY NOT NAMED

RLLHCDIKSANILLNENLNAKVSSFGLSKMAPIDKQNSFVICDIVGTPGYCDPVYMETYSVTKESDVYSFGVVMLEVLCGRLCVENSNGQLNIFVPLWKESYEQKKLDEIIFEDLKQQMDPSSLDVFADIAFQCLHTSREERPTMSLVVEKLEIALEIQE

PatternScan: PS00108
IPR008271
3-15 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

LLHCDIKSANILL

Gene3D: G3DSA:1.10.510.10
3-155 no description

LLHCDIKSANILLNENLNAKVSSFGLSKMAPIDKQNSFVICDIVGTPGYCDPVYMETYSVTKESDVYSFGVVMLEVLCGRLCVENSNGQLNIFVPLWKESYEQKKLDEIIFEDLKQQMDPSSLDVFADIAFQCLHTSREERPTMSLVVEKLEI

HMMPfam: PF00069
IPR017442
3-151 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LLHCDIKSANILLNENLNAKVSSFGLSKMAPIDKQNSFVICDIVGTPGYCDPVYMETYSVTKESDVYSFGVVMLEVLCGRLCVENSNGQLNIFVPLWKESYEQKKLDEIIFEDLKQQMDPSSLDVFADIAFQCLHTSREERPTMSLVVE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox