PRGDB00064820 (Aan.20086)

From PRG Wiki
Jump to: navigation, search
Aan.20086
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159638590 (EY065332)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CATF8768.fwd CATF Artemisia annua, Tanzanian, from Sandeman Seeds, 1-2kb Artemisia annua cDNA clone CATF8768 5', mRNA sequence

DNA Sequence

ATAGCAAACAAATATATCTTTCTTTGCCTTCATTTGTCTCCTTCTCGTTCCTAATATCTTTTTTAGTCCGAGAGATAACAAAACCACTTTCCTTGGTTCTTTCTAAACGCCATTTTTCTTACCAATATTTGATCAACAAACAATGGCATCCTTTGTAGCAGAGAACAAACATCTTGAAATCCAACTCGAAGAGATCAAATCAGCTACCGACAACTTTAATGAAAACAAAGTTGTCGGAGCTAGCGAGTCTGGAAAGGTATATGTAGGAGAACTCTCTCACTCTAAGGGCAAAAGCCTGGTTTCTATGAAGCGTATAGATCGTACATACTGGCAAGGAGAGCTCGAGTTCTATAAAGAAGTAAGGATGGTTTCTTGTTACAAGCATGAAAATCTCGTATCTCTTTTGGGATTTTGCACCGAAGGGGGTGAGATGGTCCTCGTATACGAGCATGCATCTAACGGAAGCCTCGACCAGCGTTTAAATGACGACACTCTTACATGGGCACAAAGAATCAGAATTTGTCTTGATGCTGCCAAAGGACTAAACTTCCTTCATGATCCCCAAGGGACACACCANAGACTACTTCATTGTGACATTANAAGTGCCAACATCCTGCTCAATGAAAATCTGAATGCTAAAGTTTCTAGTTTTGGGTTGTCAAAAATGGCCCCCATTGATAAGC


Protein sequences

Name Description Sequence
Aan.20086 translated coding region predicted by ESTScan from UniGene Aan.20086

MASFVAENKHLEIQLEEIKSATDNFNENKVVGASESGKVYVGELSHSKGKSLVSMKRIDRTYWQGELEFYKEVRMVSCYKHENLVSLLGFCTEGGEMVLVYEHASNGSLDQRLNDDTLTWAQRIRICLDAAKGLNFLHDPQGTHXRLLHCDIXSANILLNENLNAKVSSFGLSKMAPIDKX

Domains

Domain Start-End Description Sequence

Coil: coil
1-29 coiled-coil

MASFVAENKHLEIQLEEIKSATDNFNENK

Gene3D: G3DSA:3.30.200.20
7-90 no description

ENKHLEIQLEEIKSATDNFNENKVVGASESGKVYVGELSHSKGKSLVSMKRIDRTYWQGELEFYKEVRMVSCYKHENLVSLLGF

superfamily: SSF56112
IPR011009
14-179 Protein kinase-like (PK-like)
Protein kinase-like domain

QLEEIKSATDNFNENKVVGASESGKVYVGELSHSKGKSLVSMKRIDRTYWQGELEFYKEVRMVSCYKHENLVSLLGFCTEGGEMVLVYEHASNGSLDQRLNDDTLTWAQRIRICLDAAKGLNFLHDPQGTHXRLLHCDIXSANILLNENLNAKVSSFGLSKMAPID

HMMPanther: PTHR24420
15-180 FAMILY NOT NAMED,FAMILY NOT NAMED

LEEIKSATDNFNENKVVGASESGKVYVGELSHSKGKSLVSMKRIDRTYWQGELEFYKEVRMVSCYKHENLVSLLGFCTEGGEMVLVYEHASNGSLDQRLNDDTLTWAQRIRICLDAAKGLNFLHDPQGTHXRLLHCDIXSANILLNENLNAKVSSFGLSKMAPIDK

ProfileScan: PS50011
IPR000719
25-181 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNENKVVGASESGKVYVGELSHSKGKSLVSMKRIDRTYWQGELEFYKEVRMVSCYKHENLVSLLGFCTEGGEMVLVYEHASNGSLDQRLNDDTLTWAQRIRICLDAAKGLNFLHDPQGTHXRLLHCDIXSANILLNENLNAKVSSFGLSKMAPIDKX

HMMSmart: SM00220
IPR002290
25-181 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNENKVVGASESGKVYVGELSHSKGKSLVSMKRIDRTYWQGELEFYKEVRMVSCYKHENLVSLLGFCTEGGEMVLVYEHASNGSLDQRLNDDTLTWAQRIRICLDAAKGLNFLHDPQGTHXRLLHCDIXSANILLNENLNAKVSSFGLSKMAPIDKX

HMMSmart: SM00219
IPR020635
25-181 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNENKVVGASESGKVYVGELSHSKGKSLVSMKRIDRTYWQGELEFYKEVRMVSCYKHENLVSLLGFCTEGGEMVLVYEHASNGSLDQRLNDDTLTWAQRIRICLDAAKGLNFLHDPQGTHXRLLHCDIXSANILLNENLNAKVSSFGLSKMAPIDKX

HMMPfam: PF07714
IPR001245
28-176 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NKVVGASESGKVYVGELSHSKGKSLVSMKRIDRTYWQGELEFYKEVRMVSCYKHENLVSLLGFCTEGGEMVLVYEHASNGSLDQRLNDDTLTWAQRIRICLDAAKGLNFLHDPQGTHXRLLHCDIXSANILLNENLNAKVSSFGLSKMA

Gene3D: G3DSA:1.10.510.10
91-176 no description

CTEGGEMVLVYEHASNGSLDQRLNDDTLTWAQRIRICLDAAKGLNFLHDPQGTHXRLLHCDIXSANILLNENLNAKVSSFGLSKMA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox