PRGDB00064835 (Aan.20851)

From PRG Wiki
Jump to: navigation, search
Aan.20851
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159622053 (EY073250)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Artemisia annua

Comment?

CAZI10633.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI10633 5', mRNA sequence

DNA Sequence

GTTTGCCAATGCAAGTTTATTTTCAGTTTTGGGGAACAATAGGCTTTGTGGTGGTTTGGTTACACTTGAGTTACCCAAATGCAAGGAGACGGGTAGTAGTAAGAAAAAAAGGTTTCCTTTCTTCGTATTATTTATTTTGATTGTACGTGTTAATCGTCATTTTATGTTGTGTGTATCTCTTGTGTAAGAAGAAACGCAACAGTCAACCATCTCAATTTTTCGGGAATGAACGGTTCTTGAAAGTTTCATACAATGAACTTCTCAAGGCTACTAATGGCTTCTCTACAGAGAATTTAATTGGGGAGGGTGGGTTCAGCTATGTTTATAAAGGAATCCTTGATTCTAATGATAATAAGTTTGTTGCGGTCAAAGTTCTACATCTTCAAAATCGAGGAGCTCACAAAAGTTTTCTAGCTGAATGTGAAGCATGGCGGAATATTCGACACCGTAATCTGTTGAAGATAATAACTTCATGTTCAAGTACTGATTTCAAAGGAAATGATTTTAAAGCTTTGGTTTACGAGTTTATGCCCAATGGAAGTGTACATGATTGGCTGCATTCAAGTGCAAATACATTGAAACTCAACCTTCTTCAAAGAATAAATATTCTCAGAGATGTTGCAACAGCAGTTGATTATCTTCACAATCACTGTCANACAACGATTGTACATGGTGACTTGAAGCCTAGCAACATTCTACTTGACGATGATATGGTGGCTCATGTTGGAGACTTCGGTTTAGCTTGACTACTTG


Protein sequences

Name Description Sequence
Aan.20851 translated coding region predicted by ESTScan from UniGene Aan.20851

XFANASLFSVLGNNRLCGGLVTLELPKCKETGSSKKKRFPFFVLFILIVRVNRHFMLCVSLVKKKRNSQPSQFFGNERFLKVSYNELLKATNGFSTENLIGEGGFSYVYKGILDSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKALVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
2-248 FAMILY NOT NAMED,FAMILY NOT NAMED

FANASLFSVLGNNRLCGGLVTLELPKCKETGSSKKKRFPFFVLFILIVRVNRHFMLCVSLVKKKRNSQPSQFFGNERFLKVSYNELLKATNGFSTENLIGEGGFSYVYKGILDSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKALVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

HMMPanther: PTHR24420:SF474
2-248 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FANASLFSVLGNNRLCGGLVTLELPKCKETGSSKKKRFPFFVLFILIVRVNRHFMLCVSLVKKKRNSQPSQFFGNERFLKVSYNELLKATNGFSTENLIGEGGFSYVYKGILDSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKALVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

Gene3D: G3DSA:2.60.120.200
IPR013320
45-113 no description
Concanavalin A-like lectin/glucanase, subgroup

FILIVRVNRHFMLCVSLVKKKRNSQPSQFFGNERFLKVSYNELLKATNGFSTENLIGEGGFSYVYKGIL

superfamily: SSF56112
IPR011009
64-248 Protein kinase-like (PK-like)
Protein kinase-like domain

KKRNSQPSQFFGNERFLKVSYNELLKATNGFSTENLIGEGGFSYVYKGILDSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKALVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

ProfileScan: PS50011
IPR000719
94-248 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSTENLIGEGGFSYVYKGILDSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKALVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

HMMSmart: SM00219
IPR020635
94-248 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSTENLIGEGGFSYVYKGILDSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKALVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

HMMSmart: SM00220
IPR002290
94-248 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSTENLIGEGGFSYVYKGILDSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKALVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

HMMPfam: PF00069
IPR017442
96-248 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TENLIGEGGFSYVYKGILDSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKALVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

PatternScan: PS00107
IPR017441
100-124 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFSYVYKGILDSNDNKFVAVK

Gene3D: G3DSA:3.30.200.20
114-171 no description

DSNDNKFVAVKVLHLQNRGAHKSFLAECEAWRNIRHRNLLKIITSCSSTDFKGNDFKA

Gene3D: G3DSA:1.10.510.10
172-248 no description

LVYEFMPNGSVHDWLHSSANTLKLNLLQRINILRDVATAVDYLHNHCXTTIVHGDLKPSNILLDDDMVAHVGDFGLA

PatternScan: PS00108
IPR008271
222-234 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHGDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox