PRGDB00064895 (Aan.23261)

From PRG Wiki
Jump to: navigation, search
Aan.23261
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159631148 (EY093743)
Gene Class NL
Domain Type NBS, LRR
Gene Species Artemisia annua

Comment?

CAZI21366.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI21366 5', mRNA sequence

DNA Sequence

GTAGAATTCTCATTACAACGAGAGATGAGCAAGTATTGGTAGCACACAGAGTGAATGTGATTCGTGATATCGATCTCTTATCAAATAAGGAAGCAATTTTTCTCTTCAGTAGATACGCATTTGGAAGAGAGAATCCAGTTCAAGGATACGAAGAGCTATCAGGAGAAGTTGTACGTTATGCTGCTGGTGTTCCCTTAACAGTCATAGTCTTGGGTTCATTTCTCTGTGGTAAAGATAAGCGTGAATGGGCAGATGCAATAGACAGATTAGAAAAAATTCCCTTAAAGGACACTCTGGAAAAGCTAGAATTAAGCTATATTGGTCTGGAAGATGATTATAAGGAACTATTTCTAGTCATTGCATGCATATTCAAAGGTGAGCATATAGAAAAGGTAATCAGAGAACTTGAAAAACGGGGACTATTTCATGCTATAAATGGTATAGAAGTTCTTGAGCAGAGATCTCTCATAACTATTTCTGAAGATGGGGACTTGGGCATGCCTGACCATATAGAAGAAATGGGAAAGAACATTGGATTATTTCATGCTAGAAATGGTTTAAAAGTTCTTGAGCAGAGATCTCTCATAACTGTTGATGAAGACGGGTTTTTGGGCATGCATGACCATATAGAAGAAATGGGANAGAACATTGTTCGTCGTGAGCCTAACAAACATAGCCATTTGTGGATTGAGGAGGAAATTGAAGATATATTGGCTAATGATGACAAGGGTACTGAAGCAATAAGATGGCTAAAACTTACATCTATAAGAAATTCAATATTTGTTCTGACAGGTCTTGAAAAG


Protein sequences

Name Description Sequence
Aan.23261 translated coding region predicted by ESTScan from UniGene Aan.23261

XRILITTRDEQVLVAHRVNVIRDIDLLSNKEAIFLFSRYAFGRENPVQGYEELSGEVVRYAAGVPLTVIVLGSFLCGKDKREWADAIDRLEKIPLKDTLEKLELSYIGLEDDYKELFLVIACIFKGEHIEKVIRELEKRGLFHAINGIEVLEQRSLITISEDGDLGMPDHIEEMGKNIGLFHARNGLKVLEQRSLITVDEDGFLGMHDHIEEMGXNIVRREPNKHSHLWIEEEIEDILANDDKGTEAIRWLKLTSIRNSIFVLTGLEK

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
2-132 NB-ARC,NBS
NB-ARC

RILITTRDEQVLVAHRVNVIRDIDLLSNKEAIFLFSRYAFGRENPVQGYEELSGEVVRYAAGVPLTVIVLGSFLCGKDKREWADAIDRLEKIPLKDTLEKLELSYIGLEDDYKELFLVIACIFKGEHIEKV

superfamily: SSF52540
2-98 P-loop containing nucleoside triphosphate hydrolases

RILITTRDEQVLVAHRVNVIRDIDLLSNKEAIFLFSRYAFGRENPVQGYEELSGEVVRYAAGVPLTVIVLGSFLCGKDKREWADAIDRLEKIPLKDT

HMMPanther: PTHR11017
2-249 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RILITTRDEQVLVAHRVNVIRDIDLLSNKEAIFLFSRYAFGRENPVQGYEELSGEVVRYAAGVPLTVIVLGSFLCGKDKREWADAIDRLEKIPLKDTLEKLELSYIGLEDDYKELFLVIACIFKGEHIEKVIRELEKRGLFHAINGIEVLEQRSLITISEDGDLGMPDHIEEMGKNIGLFHARNGLKVLEQRSLITVDEDGFLGMHDHIEEMGXNIVRREPNKHSHLWIEEEIEDILANDDKGTEAIR

HMMPanther: PTHR11017:SF20
2-249 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RILITTRDEQVLVAHRVNVIRDIDLLSNKEAIFLFSRYAFGRENPVQGYEELSGEVVRYAAGVPLTVIVLGSFLCGKDKREWADAIDRLEKIPLKDTLEKLELSYIGLEDDYKELFLVIACIFKGEHIEKVIRELEKRGLFHAINGIEVLEQRSLITISEDGDLGMPDHIEEMGKNIGLFHARNGLKVLEQRSLITVDEDGFLGMHDHIEEMGXNIVRREPNKHSHLWIEEEIEDILANDDKGTEAIR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox