PRGDB00064908 (Aan.23695)

From PRG Wiki
Jump to: navigation, search
Aan.23695
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159628610 (EY098080)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

CAZI23559.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI23559 5', mRNA sequence

DNA Sequence

CTTGAGAACGGTAACTATACTGTTAACCTTCAGTTTGCAGAGCTACTAATAGAAGATGGTCCCACTTGGAGAAGTACTGGTAGGCGTGTCTTCGATATCTATTTACAGGGAAACTTGGTGTTTCAGGATTTCGATATAAAACGGGAAGCAGGTGGGGCCTCATTTAGACCTGTTTCGAGTCAAGTAACAGTTCAAGTTTCAAATAACTACCTTGAGATACATCTGTTCTGGTCTGGAAAAGGGACTTGCTGCGTACCCAATCAAGGAACATTCGGACCTCTTATTTCAGCAATAAGTGCCACCCCAAACTTTATCCCCAGTGTGAGCAACACTCCACCTTCCACAAAAAAGAAGAATAATGCCGGTTTGATTGTGGGGATAATAGTTCTAATTGCAGTTGTTGGCTTTCTGGCATTGTTAGCCCTATACATTATCCGTCAACGGAGGAAAAAGCAGGATACTTTTGACGATTATGAAGAGTTCTTAGGAATCGATGCCAGACCAAATACATTCAGTTATGCAGAATTAAGAACTGCAACAGATGATTTTAGTGCAGCAAATAAGCTTGGTGAAGGAGGTTTTGGAGCTGTTTACAAGGGAGAACTTGATGATGGGAGAGTAATAGCTGTCAAACAACTCTCGATAGCCTCACAGCAAGGCAAGAGCCAGTTTATGGCTGAAATTGCAACAATATCTGCTGTCCAACACCGCAACCTTGTAAAATTGTATGGATGCTGTATTGATGGAGAAAAACGACTTCTTGTATATGAGCATCTCGAGAACAAAAGTCTTGATCAAGCATTATTTCG


Protein sequences

Name Description Sequence
Aan.23695 translated coding region predicted by ESTScan from UniGene Aan.23695

LENGNYTVNLQFAELLIEDGPTWRSTGRRVFDIYLQGNLVFQDFDIKREAGGASFRPVSSQVTVQVSNNYLEIHLFWSGKGTCCVPNQGTFGPLISAISATPNFIPSVSNTPPSTKKKNNAGLIVGIIVLIAVVGFLALLALYIIRQRRKKQDTFDDYEEFLGIDARPNTFSYAELRTATDDFSAANKLGEGGFGAVYKGELDDGRVIAVKQLSIASQQGKSQFMAEIATISAVQHRNLVKLYGCCIDGEKRLLVYEHLENKSLDQALFR

Domains

Domain Start-End Description Sequence

HMMPfam: PF11721
IPR021720
1-98 Malectin
Malectin

LENGNYTVNLQFAELLIEDGPTWRSTGRRVFDIYLQGNLVFQDFDIKREAGGASFRPVSSQVTVQVSNNYLEIHLFWSGKGTCCVPNQGTFGPLISAI

HMMPanther: PTHR24420
53-269 FAMILY NOT NAMED,FAMILY NOT NAMED

ASFRPVSSQVTVQVSNNYLEIHLFWSGKGTCCVPNQGTFGPLISAISATPNFIPSVSNTPPSTKKKNNAGLIVGIIVLIAVVGFLALLALYIIRQRRKKQDTFDDYEEFLGIDARPNTFSYAELRTATDDFSAANKLGEGGFGAVYKGELDDGRVIAVKQLSIASQQGKSQFMAEIATISAVQHRNLVKLYGCCIDGEKRLLVYEHLENKSLDQALF

HMMPanther: PTHR24420:SF469
53-269 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ASFRPVSSQVTVQVSNNYLEIHLFWSGKGTCCVPNQGTFGPLISAISATPNFIPSVSNTPPSTKKKNNAGLIVGIIVLIAVVGFLALLALYIIRQRRKKQDTFDDYEEFLGIDARPNTFSYAELRTATDDFSAANKLGEGGFGAVYKGELDDGRVIAVKQLSIASQQGKSQFMAEIATISAVQHRNLVKLYGCCIDGEKRLLVYEHLENKSLDQALF

Seg: seg
58-67 seg

VSSQVTVQVS

Seg: seg
121-142 seg

AGLIVGIIVLIAVVGFLALLAL

superfamily: SSF56112
IPR011009
155-270 Protein kinase-like (PK-like)
Protein kinase-like domain

FDDYEEFLGIDARPNTFSYAELRTATDDFSAANKLGEGGFGAVYKGELDDGRVIAVKQLSIASQQGKSQFMAEIATISAVQHRNLVKLYGCCIDGEKRLLVYEHLENKSLDQALFR

Gene3D: G3DSA:3.30.200.20
167-258 no description

RPNTFSYAELRTATDDFSAANKLGEGGFGAVYKGELDDGRVIAVKQLSIASQQGKSQFMAEIATISAVQHRNLVKLYGCCIDGEKRLLVYEH

ProfileScan: PS50011
IPR000719
183-270 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSAANKLGEGGFGAVYKGELDDGRVIAVKQLSIASQQGKSQFMAEIATISAVQHRNLVKLYGCCIDGEKRLLVYEHLENKSLDQALFR

HMMPfam: PF07714
IPR001245
186-268 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ANKLGEGGFGAVYKGELDDGRVIAVKQLSIASQQGKSQFMAEIATISAVQHRNLVKLYGCCIDGEKRLLVYEHLENKSLDQAL

PatternScan: PS00107
IPR017441
189-211 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGAVYKGELDDGRVIAVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox