PRGDB00064963 (Aan.25455)

From PRG Wiki
Jump to: navigation, search
Aan.25455
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 283961812 (GW329539)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

AAFB_UP_021_E09_06DEC2005_071 AAFB Artemisia annua cDNA, mRNA sequence

DNA Sequence

TCACTATTTGTCACTCATAAATACTTTTTCGATATGAAATTACTCTGAGAAAAATTAGATGGAGAAAGGAAGTGTTTGTGTGACAGGAGGCACGGGATATTTAGCGTCATGGATGATCAAGAGGTTGCTTGAAGATGGATACAGCGTAAATACGACTGTTAGATCTGATTCAGGTCTAAGCAGACCAGAAACCTTCGAGGCCCCAATTAAAGGTTGCATAGGCGTCTTTCATGTTGCACATCCAATCGATTTTGTGGGCAAAGAACCTGAAGAAGTGCAAACAGAAAGAGCGATTAAGGCTAGTTTGGGTATTTTACAATCATGTATAGACTCAAAGACGGTAAAGAAAGTTGTCTACACATCTAGCGCATCCACGGTTGTGTTGAATGGAACAAAACACACTGATGTCTTAGATGAGGAATCTTGGAGCGACATTGATTACATTCGTACTCATTTTAAGGCACTTGGTACCCCGTATTTCATTTCAAAGACGTTGACCGAGAAAGCAACAATTGAGTTCGCTGAGAAAAATGGGTTGGATGTTGTGACCATCATTCCCACCTATATTCATGGTCCATTTGTTGTTCCTCACTGCCCCAGA


Protein sequences

Name Description Sequence
Aan.25455 translated coding region predicted by ESTScan from UniGene Aan.25455

MEKGSVCVTGGTGYLASWMIKRLLEDGYSVNTTVRSDSGLSRPETFEAPIKGCIGVFHVAHPIDFVGKEPEEVQTERAIKASLGILQSCIDSKTVKKVVYTSSASTVVLNGTKHTDVLDEESWSDIDYIRTHFKALGTPYFISKTLTEKATIEFAEKNGLDVVTIIPTYIHGPFVVPHCPR

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
1-177 NAD(P)-binding Rossmann-fold domains

MEKGSVCVTGGTGYLASWMIKRLLEDGYSVNTTVRSDSGLSRPETFEAPIKGCIGVFHVAHPIDFVGKEPEEVQTERAIKASLGILQSCIDSKTVKKVVYTSSASTVVLNGTKHTDVLDEESWSDIDYIRTHFKALGTPYFISKTLTEKATIEFAEKNGLDVVTIIPTYIHGPFVVP

HMMPanther: PTHR10366
1-175 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MEKGSVCVTGGTGYLASWMIKRLLEDGYSVNTTVRSDSGLSRPETFEAPIKGCIGVFHVAHPIDFVGKEPEEVQTERAIKASLGILQSCIDSKTVKKVVYTSSASTVVLNGTKHTDVLDEESWSDIDYIRTHFKALGTPYFISKTLTEKATIEFAEKNGLDVVTIIPTYIHGPFV

HMMPanther: PTHR10366:SF9
1-175 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

MEKGSVCVTGGTGYLASWMIKRLLEDGYSVNTTVRSDSGLSRPETFEAPIKGCIGVFHVAHPIDFVGKEPEEVQTERAIKASLGILQSCIDSKTVKKVVYTSSASTVVLNGTKHTDVLDEESWSDIDYIRTHFKALGTPYFISKTLTEKATIEFAEKNGLDVVTIIPTYIHGPFV

HMMPfam: PF01370
IPR001509
6-174 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGGTGYLASWMIKRLLEDGYSVNTTVRSDSGLSRPETFEAPIKGCIGVFHVAHPIDFVGKEPEEVQTERAIKASLGILQSCIDSKTVKKVVYTSSASTVVLNGTKHTDVLDEESWSDIDYIRTHFKALGTPYFISKTLTEKATIEFAEKNGLDVVTIIPTYIHGPF

Gene3D: G3DSA:3.40.50.720
IPR016040
6-174 no description
NAD(P)-binding domain

VCVTGGTGYLASWMIKRLLEDGYSVNTTVRSDSGLSRPETFEAPIKGCIGVFHVAHPIDFVGKEPEEVQTERAIKASLGILQSCIDSKTVKKVVYTSSASTVVLNGTKHTDVLDEESWSDIDYIRTHFKALGTPYFISKTLTEKATIEFAEKNGLDVVTIIPTYIHGPF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox