PRGDB00065359 (Aan.75235)

From PRG Wiki
Jump to: navigation, search
Aan.75235
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259735382 (EZ184131)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Artemis Contig7607.Ac mRNA sequence

DNA Sequence

GAATTCTTTCGAGGGCACCAATGTCTAGAACTGGAGTCTTTCCATGATGGTTTTTCAATGTTAATGGACCTAAAGATGGTCTTTGGATTCCATATTTTTGTGTGTCACCAAGAATAAACCATGTTAGGACTAACAGAATCTTGTCAACTAGCCATAATGGTAGCCATTTCATTAGCATCATTGCTAGATCAAATGTAGATTTTCCCATAATTTCACGAGGCAAAACATGCACCGAGCTTCGAACAACCATTGAAGGTTTAGCATTGTGGTTTGAGAGGTCTAATGAGAGTTCCATGCCAGAATTCCCACATCCGACAACTAATACTTTCTTTCCTGTGTATTTTTCACCAGACTTGTAGTCTTTAGCATGGATGACTTCACCAGAGAAGTCTTTTAGTCCATCAACCCC


Protein sequences

Name Description Sequence
Aan.75235 translated coding region predicted by ESTScan from UniGene Aan.75235

GVDGLKDFSGEVIHAKDYKSGEKYTGKKVLVVGCGNSGMELSLDLSNHNAKPSMVVRSSVHVLPREIMGKSTFDLAMMLMKWLPLWLVDKILLVLTWFILGDTQKYGIQRPSLGPLTLKNHHGKTPVLDIGALERIX

Domains

Domain Start-End Description Sequence

superfamily: SSF51905
1-65 FAD/NAD(P)-binding domain

GVDGLKDFSGEVIHAKDYKSGEKYTGKKVLVVGCGNSGMELSLDLSNHNAKPSMVVRSSVHVLPR

HMMPanther: PTHR23023:SF5
2-136 MONOOXYGENASE,MONOOXYGENASE

VDGLKDFSGEVIHAKDYKSGEKYTGKKVLVVGCGNSGMELSLDLSNHNAKPSMVVRSSVHVLPREIMGKSTFDLAMMLMKWLPLWLVDKILLVLTWFILGDTQKYGIQRPSLGPLTLKNHHGKTPVLDIGALERI

HMMPanther: PTHR23023
2-136 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

VDGLKDFSGEVIHAKDYKSGEKYTGKKVLVVGCGNSGMELSLDLSNHNAKPSMVVRSSVHVLPREIMGKSTFDLAMMLMKWLPLWLVDKILLVLTWFILGDTQKYGIQRPSLGPLTLKNHHGKTPVLDIGALERI

HMMPfam: PF00743
IPR020946
3-85 FMO-like
Flavin-containing monooxygenase-like

DGLKDFSGEVIHAKDYKSGEKYTGKKVLVVGCGNSGMELSLDLSNHNAKPSMVVRSSVHVLPREIMGKSTFDLAMMLMKWLPL

Gene3D: G3DSA:3.50.50.60
4-89 no description

GLKDFSGEVIHAKDYKSGEKYTGKKVLVVGCGNSGMELSLDLSNHNAKPSMVVRSSVHVLPREIMGKSTFDLAMMLMKWLPLWLVD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox