PRGDB00065555 (Aan.102088)

From PRG Wiki
Jump to: navigation, search
Aan.102088
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259874378 (EZ284937)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Madagascar Contig11324, mRNA sequence

DNA Sequence

CGTGTCTCTAGTTGACTCGTTGAGGTGAGCAATTTGCTGCAAGCACTTCACTATCTGAAACGTAGTAGAACTGTCTAAACCAGTTGATATCTCATCCATAAACAAAGTTTTTGCAGGCCCAACAAGCATCTCACCTGTAGTAAATCGCTTCTTTTGTCCACCAGAGATCCCTCGCCTCATTACATCACCAACAACAGTGTCACGACAAAAATCCAAGCCCAATATTCTAAGAGTGTAGTAAGTAATC


Protein sequences

Name Description Sequence
Aan.102088 translated coding region predicted by ESTScan from UniGene Aan.102088

XITYYTLRILGLDFCRDTVVGDVMRRGISGGQKKRFTTGEMLVGPAKTLFMDEISTGLDSSTTFQIVKCLQQIAHLNESTRDT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF96
3-80 OS12G0512700 PROTEIN (FRAGMENT)

TYYTLRILGLDFCRDTVVGDVMRRGISGGQKKRFTTGEMLVGPAKTLFMDEISTGLDSSTTFQIVKCLQQIAHLNEST

HMMPanther: PTHR19241
3-80 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

TYYTLRILGLDFCRDTVVGDVMRRGISGGQKKRFTTGEMLVGPAKTLFMDEISTGLDSSTTFQIVKCLQQIAHLNEST

Gene3D: G3DSA:3.40.50.300
4-76 no description

YYTLRILGLDFCRDTVVGDVMRRGISGGQKKRFTTGEMLVGPAKTLFMDEISTGLDSSTTFQIVKCLQQIAHL

superfamily: SSF52540
29-75 P-loop containing nucleoside triphosphate hydrolases

SGGQKKRFTTGEMLVGPAKTLFMDEISTGLDSSTTFQIVKCLQQIAH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox