PRGDB00065556 (Aan.102137)

From PRG Wiki
Jump to: navigation, search
Aan.102137
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259874051 (EZ284610)
Gene Class Unknown
Domain Type LRR
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Madagascar Contig10997, mRNA sequence

DNA Sequence

CGTGTCTCTAAAACAATTATTTCGAAAGGGGAATACCAGAAATAATCGGGAATTTGAGCTCTCTATAAGTACTCAACCTGCCCCATAATAGTCTCAATGGTCGAATCCCAGACTCTCTTGGAAAACTATCAGAAATTGAATCATTAGACCTCTCTTGGAACCAACTCACAGGAAATATCCCTCAAAGCCTTGCAGGAATCAAGGGCCTTGAAGTCTTAAATCTATCACAAAACCATCTCGTGGGGCGTATTCCAGAAGGAACACAGGTCAACACATTTCAAGAGAACTCATTTGAAGGGAATTTGGGACTCTGTGGGTTTCCACTGCCCAAAAAGTGCAGTGAGAATGCACACAAACCACAGCTTGAAGCAGAAGAACATCATGAGGAGGAAAGTGGATTTACGTGGGAAGTGGTGATATTGGGATACGGATGTGGGACCCTACTTGGATTGGTGATGGGTTC


Protein sequences

Name Description Sequence
Aan.102137 translated coding region predicted by ESTScan from UniGene Aan.102137

XVSLKQLFRKGNTRNNREFELSISTQPAPNSLNGRIPDSLGKLSEIESLDLSWNQLTGNIPQSLAGIKGLEVLNLSQNHLVGRIPEGTQVNTFQENSFEGNLGLCGFPLPKKCSENAHKPQLEAEEHHEEESGFTWEVVILGYGCGTLLGLVMGS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF500
30-153 SUBFAMILY NOT NAMED

NSLNGRIPDSLGKLSEIESLDLSWNQLTGNIPQSLAGIKGLEVLNLSQNHLVGRIPEGTQVNTFQENSFEGNLGLCGFPLPKKCSENAHKPQLEAEEHHEEESGFTWEVVILGYGCGTLLGLVM

HMMPanther: PTHR26393
30-153 FAMILY NOT NAMED,FAMILY NOT NAMED

NSLNGRIPDSLGKLSEIESLDLSWNQLTGNIPQSLAGIKGLEVLNLSQNHLVGRIPEGTQVNTFQENSFEGNLGLCGFPLPKKCSENAHKPQLEAEEHHEEESGFTWEVVILGYGCGTLLGLVM

Gene3D: G3DSA:3.80.10.10
30-109 no description

NSLNGRIPDSLGKLSEIESLDLSWNQLTGNIPQSLAGIKGLEVLNLSQNHLVGRIPEGTQVNTFQENSFEGNLGLCGFPL

superfamily: SSF52058
30-113 L domain-like,LRR

NSLNGRIPDSLGKLSEIESLDLSWNQLTGNIPQSLAGIKGLEVLNLSQNHLVGRIPEGTQVNTFQENSFEGNLGLCGFPLPKKC

FPrintScan: PR00019
46-59 LEURICHRPT,Leucine-rich repeat signature

IESLDLSWNQLTGN

HMMPfam: PF12799
46-80 LRR_4,Leucine Rich repeats (2 copies)

IESLDLSWNQLTGNIPQSLAGIKGLEVLNLSQNHL

FPrintScan: PR00019
67-80 LEURICHRPT,Leucine-rich repeat signature

IKGLEVLNLSQNHL

Seg: seg
123-131 seg

EAEEHHEEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox