PRGDB00065557 (Aan.102293)

From PRG Wiki
Jump to: navigation, search
Aan.102293
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259873066 (EZ283625)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Madagascar Contig10012, mRNA sequence

DNA Sequence

GGCGATCAAGGCTACCATTAGATGCAAGTTCATACACCAAAATCATCTCACCACCCTCGTTGCAATATCCAAGGAGAGAGATGAGATTTTCGTGGGTGTAACGGGAAAGCATCATGACCTCCTTCCAGAACTCAGGGCCACCTTGCCCGTGTTTACGATCTAAACGCTTAAAAGCCGCCTTAGTTTTCCCCCTTGGTTGAGATAGTTCTCCTTCATATACATATCCGAAACCACCCTTTCCGATGATTTTGGCGTCATTAAAGTTGTCAGTGGCTGATTTGACCTCCTTTAGTTGACTACAAGATGTTCAAACTCCTTCATGATGGAATCC


Protein sequences

Name Description Sequence
Aan.102293 translated coding region predicted by ESTScan from UniGene Aan.102293

GFHHEGVXTSCSQLKEVKSATDNFNDAKIIGKGGFGYVYEGELSQPRGKTKAAFKRLDRKHGQGGPEFWKEVMMLSRYTHENLISLLGYCNEGGEMILVYELASNGSLDRX

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
12-102 no description

SQLKEVKSATDNFNDAKIIGKGGFGYVYEGELSQPRGKTKAAFKRLDRKHGQGGPEFWKEVMMLSRYTHENLISLLGYCNEGGEMILVYEL

superfamily: SSF56112
IPR011009
13-110 Protein kinase-like (PK-like)
Protein kinase-like domain

QLKEVKSATDNFNDAKIIGKGGFGYVYEGELSQPRGKTKAAFKRLDRKHGQGGPEFWKEVMMLSRYTHENLISLLGYCNEGGEMILVYELASNGSLDR

HMMPanther: PTHR24420
14-110 FAMILY NOT NAMED,FAMILY NOT NAMED

LKEVKSATDNFNDAKIIGKGGFGYVYEGELSQPRGKTKAAFKRLDRKHGQGGPEFWKEVMMLSRYTHENLISLLGYCNEGGEMILVYELASNGSLDR

ProfileScan: PS50011
IPR000719
24-111 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNDAKIIGKGGFGYVYEGELSQPRGKTKAAFKRLDRKHGQGGPEFWKEVMMLSRYTHENLISLLGYCNEGGEMILVYELASNGSLDRX

HMMPfam: PF07714
IPR001245
28-109 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KIIGKGGFGYVYEGELSQPRGKTKAAFKRLDRKHGQGGPEFWKEVMMLSRYTHENLISLLGYCNEGGEMILVYELASNGSLD

PatternScan: PS00107
IPR017441
30-55 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGGFGYVYEGELSQPRGKTKAAFK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox