PRGDB00065560 (Aan.102527)

From PRG Wiki
Jump to: navigation, search
Aan.102527
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259579655 (EZ272286)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Madagascar Contig15389 mRNA sequence

DNA Sequence

GACGCACTCAACATCAAGAGCTCCAAGATTTGGTTGAATCAAAACTGGGAACCCACCTTACATGGTCTTAGAGCTGACATGATTGTTAAAAAACATGGTGTTCACCATCCTAGTAATTATGATGGCACGTCACAATATACCGATCCAGCTTATGAAAAAACCAAACGTTTATCTCACAAGTCAGACGTCTACTCCTTCGGAGTTGTTTTGTTTGAAGTATTGCTTGGGAGGGTAGCGTCTATTCCAATTTCAGACCAAGATGATTGGAGTTTTGCTCGATTTGCCCGTTTGCACTATGAACGGAAAACACTCAGTGATATAATCGATCCTGTTCTACGACAACAAATGGATTCGCAATCGTTAAAGAACTTCTCAGAAACAGCATATTATTG


Protein sequences

Name Description Sequence
Aan.102527 translated coding region predicted by ESTScan from UniGene Aan.102527

DALNIKSSKIWLNQNWEPTLHGLRADMIVKKHGVHHPSNYDGTSQYTDPAYEKTKRLSHKSDVYSFGVVLFEVLLGRVASIPISDQDDWSFARFARLHYERKTLSDIIDPVLRQQMDSQSLKNFSETAYYX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-131 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DALNIKSSKIWLNQNWEPTLHGLRADMIVKKHGVHHPSNYDGTSQYTDPAYEKTKRLSHKSDVYSFGVVLFEVLLGRVASIPISDQDDWSFARFARLHYERKTLSDIIDPVLRQQMDSQSLKNFSETAYYX

superfamily: SSF56112
IPR011009
4-130 Protein kinase-like (PK-like)
Protein kinase-like domain

NIKSSKIWLNQNWEPTLHGLRADMIVKKHGVHHPSNYDGTSQYTDPAYEKTKRLSHKSDVYSFGVVLFEVLLGRVASIPISDQDDWSFARFARLHYERKTLSDIIDPVLRQQMDSQSLKNFSETAYY

Gene3D: G3DSA:1.10.510.10
4-128 no description

NIKSSKIWLNQNWEPTLHGLRADMIVKKHGVHHPSNYDGTSQYTDPAYEKTKRLSHKSDVYSFGVVLFEVLLGRVASIPISDQDDWSFARFARLHYERKTLSDIIDPVLRQQMDSQSLKNFSETA

HMMPfam: PF00069
IPR017442
35-86 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HHPSNYDGTSQYTDPAYEKTKRLSHKSDVYSFGVVLFEVLLGRVASIPISDQ

HMMPanther: PTHR24420:SF418
46-128 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YTDPAYEKTKRLSHKSDVYSFGVVLFEVLLGRVASIPISDQDDWSFARFARLHYERKTLSDIIDPVLRQQMDSQSLKNFSETA

HMMPanther: PTHR24420
46-128 FAMILY NOT NAMED,FAMILY NOT NAMED

YTDPAYEKTKRLSHKSDVYSFGVVLFEVLLGRVASIPISDQDDWSFARFARLHYERKTLSDIIDPVLRQQMDSQSLKNFSETA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox