PRGDB00065561 (Aan.103524)

From PRG Wiki
Jump to: navigation, search
Aan.103524
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 259582194 (EZ291537)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

TSA: Artemisia annua strain Madagascar Contig17924.Mt mRNA sequence

DNA Sequence

CGTGTCTCTAAAAATAGACAGTCGTGTTAGGTTTGGAAACTTTAATACTGTCCCCTGCTTGCTCTTCCATATATACTTGAGACTAAATAAACACCCCAAGTCCACTTGTCTCAAGTTTGGAATTTCAGCATCAGTTTCTGAATCAAATATCTCCTCAATGCCCCGACAACTACTAAAATGGACAGTTTCAAGCTTTTGCAGTTGTGACACTTCATCAGATGAAAAAAGGGTCTGCCCACCACTGGTGTTACAATTGTACATATTCGCTTTAATCAAATTATGATAAGACCAAGGCAACCGCTCCATAGTAGTAGGGCCGTATGAGCTTGTACTTTCATAACTCGGTAATAGTAGAGACACG


Protein sequences

Name Description Sequence
Aan.103524 translated coding region predicted by ESTScan from UniGene Aan.103524

XVSLLLPSYESTSSYGPTTMERLPWSYHNLIKANMYNCNTSGGQTLFSSDEVSQLQKLETVHFSSCRGIEEIFDSETDAEIPNLRQVDLGCLFSLKYIWKSKQGTVLKFPNLTRLSIFRDT







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox